KEGG   Nocardiopsis dassonvillei: Ndas_4338Help
Entry
Ndas_4338         CDS       T01248                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00260  Glycine, serine and threonine metabolism
nda00680  Methane metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
nda01230  Biosynthesis of amino acids
Module
nda_M00002  Glycolysis, core module involving three-carbon compounds
nda_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_4338
  Energy metabolism
   00680 Methane metabolism
    Ndas_4338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_4338
Enzymes [BR:nda01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ndas_4338
Membrane trafficking [BR:nda04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Ndas_4338
Exosome [BR:nda04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ndas_4338
  Exosomal proteins of melanoma cells
   Ndas_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADH69727
UniProt: D7AW67
Position
1:5173355..5174101
Genome map
AA seq 248 aa AA seqDB search
MGTLVLLRHGESVWNAKGLFTGWVDVDLSATGEEEARRGGELLKEAGVRPDVVYTSLLKR
AIRTANLALETADLHWLPVERTWRLNERHYGALQGKDKAQTREEYGEEQFMIWRRSYDTP
PPPIADDDTYSQAGDARYGELPPELLPRTECLKDVLDRALPYWYDSIVPDLAAGKTVLVA
AHGNSLRALVKHLDGVSDADIAGLNIPTGIPLRYDLDDQFKPTNPGGTYLDPEAAKSAIE
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggaactctggtactgctgcgacacggtgagagcgtctggaacgcgaagggcctgttc
accggctgggtggacgtggacctgtccgcgacgggcgaggaggaggcccgccggggcggc
gagctgctcaaggaggccggcgtacggccggacgtggtctacacctccctgctcaagcgc
gcgatccgcaccgcgaacctcgccctggagaccgccgacctgcactggctgccggtcgag
cgcacctggcgcctcaacgagcgccactacggcgcactgcagggcaaggacaaggcgcag
acgcgcgaggagtacggcgaagagcagttcatgatctggcgccgctcctacgacaccccg
ccgccgcccatcgcggacgacgacacctactcgcaggccggtgacgcccgctacggcgag
ctgccgccggagctgctgccgcgcaccgagtgcctcaaggacgtgctggaccgcgccctg
ccgtactggtacgactcgatcgtgccggacctggccgcgggcaagaccgtgctggtcgcc
gcgcacggcaactcgctgcgcgcgctggtcaagcacctggacggcgtcagcgacgccgac
atcgccgggctgaacatcccgacgggcatcccgctgcgctacgacctggacgaccagttc
aagccgaccaaccccggcggcacctacctcgacccggaggcggccaagtccgccatcgag
gccgtcgccaaccagggcaagaagtaa

DBGET integrated database retrieval system