KEGG   Nocardiopsis dassonvillei: Ndas_4338Help
Entry
Ndas_4338         CDS       T01248                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4 5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_4338
   01230 Biosynthesis of amino acids
    Ndas_4338
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_4338
  Energy metabolism
   00680 Methane metabolism
    Ndas_4338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ndas_4338
Enzymes [BR:nda01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ndas_4338
Exosome [BR:nda04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ndas_4338
  Exosomal proteins of melanoma cells
   Ndas_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:5173355..5174101
Genome map
AA seq 248 aa AA seqDB search
MGTLVLLRHGESVWNAKGLFTGWVDVDLSATGEEEARRGGELLKEAGVRPDVVYTSLLKR
AIRTANLALETADLHWLPVERTWRLNERHYGALQGKDKAQTREEYGEEQFMIWRRSYDTP
PPPIADDDTYSQAGDARYGELPPELLPRTECLKDVLDRALPYWYDSIVPDLAAGKTVLVA
AHGNSLRALVKHLDGVSDADIAGLNIPTGIPLRYDLDDQFKPTNPGGTYLDPEAAKSAIE
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggaactctggtactgctgcgacacggtgagagcgtctggaacgcgaagggcctgttc
accggctgggtggacgtggacctgtccgcgacgggcgaggaggaggcccgccggggcggc
gagctgctcaaggaggccggcgtacggccggacgtggtctacacctccctgctcaagcgc
gcgatccgcaccgcgaacctcgccctggagaccgccgacctgcactggctgccggtcgag
cgcacctggcgcctcaacgagcgccactacggcgcactgcagggcaaggacaaggcgcag
acgcgcgaggagtacggcgaagagcagttcatgatctggcgccgctcctacgacaccccg
ccgccgcccatcgcggacgacgacacctactcgcaggccggtgacgcccgctacggcgag
ctgccgccggagctgctgccgcgcaccgagtgcctcaaggacgtgctggaccgcgccctg
ccgtactggtacgactcgatcgtgccggacctggccgcgggcaagaccgtgctggtcgcc
gcgcacggcaactcgctgcgcgcgctggtcaagcacctggacggcgtcagcgacgccgac
atcgccgggctgaacatcccgacgggcatcccgctgcgctacgacctggacgaccagttc
aagccgaccaaccccggcggcacctacctcgacccggaggcggccaagtccgccatcgag
gccgtcgccaaccagggcaagaagtaa

DBGET integrated database retrieval system