KEGG   Nocardiopsis dassonvillei: Ndas_4369Help
Entry
Ndas_4369         CDS       T01248                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ndas_4369
Enzymes [BR:nda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ndas_4369
Exosome [BR:nda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ndas_4369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5203114..5204112)
Genome map
AA seq 332 aa AA seqDB search
MNASSNDAAFPVVRPRRLRRGPALRRLVAETRVRPENLVLPMFVKEGITEPVAVSSMPGQ
VQHTRDSLRKAAHEAAAAGVGGLMLFGIPAHKDAHGSAADDPEGIVQAALRDLSAEVGDD
LVVMADLCLCEYTDHGHCGPLEVDGHVDNDLTLERYASVAAAQAEAGAAVVAPSGMMDGQ
VAAIRAGLDRTGHQQVPILAYAAKYASAFYGPFREAAEGAPQFGDRSGYQQDPANAREAL
REVALDVAEGADMVMVKPGLAYLDIVAKVAEASPVPVSAYQVSGEYAMIEAAAERGWIDR
ERAIVETLTSYRRAGAEQILTYWATEAARLLR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcctccagcaacgacgccgccttccccgtggtccggccgcgccgcctgcgccgc
ggtccggcgctgcgccgcctggtcgccgagacccgggtccgccccgagaacctcgtcctg
ccgatgttcgtcaaggagggcatcaccgagccggtcgccgtctcctcgatgcccggccag
gtgcagcacacgcgtgacagcctgcgcaaggcggcccacgaggcggccgccgccggagtg
ggcgggctgatgctgttcggcatccccgcgcacaaggacgcgcacggctcggccgccgac
gaccccgaggggatcgtccaggccgccctgcgcgacctgtccgccgaggtcggcgacgac
ctcgtggtgatggccgacctgtgcctgtgcgagtacaccgaccacggccactgcggcccg
ctggaggtggacgggcacgtcgacaacgacctcaccctggagcggtacgcgtccgtggcc
gccgcccaggccgaggcgggcgccgccgtggtggcgcccagcggcatgatggacggccag
gtcgcggcgatccgcgccgggctggaccgcaccgggcaccagcaggtgcccatcctggcc
tacgccgccaagtacgcgtcggcgttctacggccccttccgcgaggccgcggagggcgcg
ccgcagttcggcgaccgctccggctaccagcaggaccccgccaacgcgcgcgaggcgctg
cgcgaggtggcactggacgtcgccgagggcgcggacatggtgatggtcaaacccggcctg
gcctacctcgacatcgtggccaaggtggccgaggcctccccggtacccgtgtcggcctac
caggtcagcggcgagtacgcgatgatcgaggcggccgcggagcggggctggatcgaccgc
gagcgggccatcgtggagacactgacctcctaccgcagggccggggccgagcagatcctc
acctactgggcgaccgaggccgcccgcctgctgcggtag

DBGET integrated database retrieval system