KEGG   Nocardiopsis dassonvillei: Ndas_4418Help
Entry
Ndas_4418         CDS       T01248                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00220  Arginine biosynthesis
nda00250  Alanine, aspartate and glutamate metabolism
nda00471  D-Glutamine and D-glutamate metabolism
nda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ndas_4418
   00220 Arginine biosynthesis
    Ndas_4418
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Ndas_4418
Enzymes [BR:nda01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Ndas_4418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADH69807
UniProt: D7AX37
Position
1:5256606..5257532
Genome map
AA seq 308 aa AA seqDB search
MSDRDDYAEVLDAVMERVRSHIGEGRVADYIPELANVDPDEFGFAVATVDGDLYSVGDHS
RTRFSMQSITKVFTLALVMSRSGDSVWKRVHREPSGNSFNSLYQLEFESGVPRNPMINPG
ALIVTDQLLSDTGDAVGALGELLCAETGDPDLHTDNLVARSEDEHGDRNRSLAYLMSSFG
NMRNPVPEVLDHYFRQCAITVSCEELARVGLLLARHGRRADGSQLLSRSDARRVMAVMLT
CGTYDAAGEFAYRVGLPCKSGVGGGILAIVPGRCSVAAWGPGLDAKGNSVTAALALEAFT
DITNCSVF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgcgacgactacgcagaggtgctcgacgccgtcatggagagggtgcggtcg
cacatcggcgagggccgggtcgccgactacatccccgaactggccaacgtggacccggac
gagttcgggttcgccgtggccacggtggacggcgacctgtacagcgtcggcgaccactcc
cgcacgcgcttctccatgcagagcatcaccaaggtgttcaccctggcgctggtgatgagc
aggtccggggacagcgtgtggaagcgggtccaccgggagccctcgggcaactccttcaac
tccctgtaccagctggagttcgagagcggtgtgccccgcaacccgatgatcaacccgggc
gcgctcatcgtcaccgaccagctgctgtccgacaccggggacgccgtcggcgccctgggg
gagctgctgtgcgcggagacgggcgaccccgacctgcacacggacaacctggtggcgcgc
tcggaggacgagcacggcgaccgcaaccggtcgctggcctacctcatgtcgagcttcggc
aacatgcgcaacccggtgccggaggttctggaccactacttccggcagtgcgcgatcacc
gtcagctgtgaggagctggcccgggtggggctgctgctggcgcgccacggcaggcgggcg
gacggctcccagctgctcagccgctccgacgcgcgccgcgtcatggcggtgatgctcacc
tgcggcacctacgacgccgcgggtgagttcgcctaccgtgtcggcctgccctgcaagagc
ggggtgggcggcggcatcctcgcgatcgtgccggggcgctgctccgtggcggcgtgggga
cccggcctggacgccaagggcaactcggtgacggcggcgctggccctggaggccttcacc
gacatcaccaactgctccgtgttctga

DBGET integrated database retrieval system