KEGG   Nocardiopsis dassonvillei: Ndas_4806Help
Entry
Ndas_4806         CDS       T01248                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00020  Citrate cycle (TCA cycle)
nda00620  Pyruvate metabolism
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
Module
nda_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_4806
   00020 Citrate cycle (TCA cycle)
    Ndas_4806
   00620 Pyruvate metabolism
    Ndas_4806
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ndas_4806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: ADH70190
UniProt: D7B0A2
Position
1:5696069..5697379
Genome map
AA seq 436 aa AA seqDB search
MSEIQMPRLSDTMEEGVISTWVKNVGDKVASGDVLVEIETDKAVMEYEAYEDGYLVKQSV
SEGETVPIGAVIGVIADSPDAVPEDSGDGGSEPEAAPAEEEQGEKAEEIQEAAEGTEAES
AGESAASSGDGAARPRTSPLARRLAKEYGLDINRIQGSGPKGRIVRADIEAAREGGAAEQ
AAPAAQPKEEAKPAAEKAATAPAFDDGRASEELKVSNVRKVIARRLTESKQTVPHFYLRR
TIDAEALKAFRAQINEQLSSTGVKVSFNDLIVKASATALKLHPAVNTSWVDDKLLQHHRV
NVGVAVAVDAGLVVPVLHDTDKATLSEISTRTRELAGKARDGKLKPQEMSGGTFSVSNLG
MFGVDSFSAVINPPEAAILAVGAMRQEPVVVDGEVVVRNRISLELSVDHRAVDGAVGAAF
LKDLAEILEEPMRIIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatccagatgccgcgcctctccgacaccatggaggaaggcgtcatcagcacg
tgggtcaagaacgtgggcgacaaggtcgcctccggtgacgtcctggtcgagatcgagacc
gacaaggccgtcatggagtacgaggcctacgaggacggctacctggtcaagcagtccgtc
tccgagggcgagacggtgccgatcggcgcggtcatcggcgtgatcgccgactccccggac
gcggtacccgaggactccggcgacggcggctcggagcccgaggccgcgcccgccgaggag
gagcagggcgagaaggcggaggagatccaggaggccgccgagggcaccgaggccgagagc
gccggggagtccgccgcctcctccggcgatggggccgcgcgcccgcgcacctccccgctg
gcccggcgtctggccaaggagtacggcctggacatcaacaggatccaggggtcgggcccc
aagggccggatcgtgcgcgccgacatcgaggccgcccgggaaggcggtgccgccgagcag
gccgcacccgccgcgcagcccaaggaggaggccaagcccgccgcggagaaggcggcgacc
gctcccgccttcgacgacggccgcgcctccgaggagctcaaggtcagcaacgtgcgcaag
gtgatcgcgcgccgcctgaccgagagcaagcagacggtgccgcacttctacctgcgccgc
acgatcgacgccgaggcgctcaaggccttccgcgcgcagatcaacgagcagctgtccagc
acgggcgtgaaggtcagcttcaacgacctgatcgtcaaggccagcgcgacggcgctgaag
ctgcacccggcggtgaacacctcgtgggtggacgacaagctgctccagcaccaccgggtc
aacgtcggcgtggccgtggccgtggacgccgggctcgtggtgccggtgctgcacgacacc
gacaaggcgacgctgtcggagatctccacgcgcacgcgcgagctggcgggcaaggcccgt
gacggcaagctcaagccgcaggagatgagcggcggcacgttcagcgtgtccaacctgggc
atgttcggcgtggacagcttctccgcggtgatcaacccgccggaggcggccatcctcgcg
gtcggcgcgatgcgccaggagccggtggtcgtggacggcgaggtcgtcgtgcgcaaccgg
atctccctggagctgtcggtggaccaccgcgcggtggacggcgccgtgggcgccgcgttc
ctcaaggacctcgcggagatcctggaagagccgatgcggatcatcctgtag

DBGET integrated database retrieval system