KEGG   Nocardiopsis dassonvillei: Ndas_4814Help
Entry
Ndas_4814         CDS       T01248                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nda  Nocardiopsis dassonvillei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nda03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5704149..5704748)
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQNLIDELGRLPGVGPKSAQRIAFHLLSAEHADVKRLVSALVEVKEKVRFCSVCG
NVAEEDQCRICRDVRRDPAIICVVEESKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRIKELMTRLADGQVTELILATDPNLEGEATATYLARLVKPMGLKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRSLEF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaggcgcggtgcagaatctgatcgacgagctcgggcggctgcccggcgtcggt
ccgaaaagcgcgcagcgcatcgccttccacctcctgtccgccgagcacgccgacgtcaaa
cgcctcgtcagcgcgctcgtcgaggtcaaggagaaggtgcgcttctgctcggtctgcggc
aacgtcgccgaagaggaccagtgccgcatctgccgcgacgtccgccgcgaccccgccatc
atctgcgtggtcgaggagtccaaggacgtcgtcgccatcgagcgcacccgcgagttccgg
ggccgctaccacgtcctgggcggcgccatcagccccatcgagggtgtgggccccgacgac
ctgcgcatcaaggaactcatgacccgcctggccgacggccaggtgacggagctgatcctg
gccacggatcccaacctggaaggggaggccaccgcgacctatctggcgcggctggtcaaa
cccatggggttgaaggtgacccgtctggccagtggcctgcccgtgggcggcgacctggag
tacgccgacgaggtcaccctcggtcgtgccttcgagggccgccgcagcctggagttctag

DBGET integrated database retrieval system