KEGG   Nocardiopsis dassonvillei: Ndas_4826Help
Entry
Ndas_4826         CDS       T01248                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ndas_4826
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ndas_4826
   00600 Sphingolipid metabolism
    Ndas_4826
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ndas_4826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5718193..5720367)
Genome map
AA seq 724 aa AA seqDB search
MASHRPLSGGSDLPHLRAAGVSLLLDLTGQTLPRVLHWGSDLGDLSRGELDDLRLALSPQ
PIGFSVDGPVEVAVLPEQSAGWLGTPGLVGNRGGADFSTAFRVRESAVEHRSPAGGRLTV
RAEDARAGLSLDLVVELTPSGLVRQRATVTNGAASPFAVDAVNLVLPVPAEAVELLDFGG
RHMRERSPQRTAFTQGLRVRENRTGRTGYDAAHLLAAGTHGSGNRSGEVWAVHTAWSGNH
RTFAERTYHAVSLLGSGELLLSGEVVLAEGESYTTPWQYGSHGHGLDEVSARFHRHLRSR
PHHPSTPRPVVVNTWEAVYFDHGLDRLRELADAAARVGAERFVLDDGWFGSRRDDRRGLG
DWYVSDEVWPDGLGPLTDHVTGLGMQFGLWVEPEMVNEDSDLARAHPDWIMAAGDRLPRP
ARSQQVLDLARPEAFAYVLERLDDLLSAYPVSYLKWDHNRDLVDAGHRPTGRAGVHGQTL
AVYRLMDELRRRHPAVEIESCSSGGGRVDLGVLERTDRVWVSDCIDALERQDIQRWTNAL
VPLELMGTHVGAGTAHTTDRRHTVDFRAGTALFGHFGIEWDLTRADPADLARLREWVELY
KELRGLLHTGTAVHGDHPDPAVRVHGVVAEDGSEALYAIVATGTSELYPTGPVRLPGLRP
EAVYRVRPQAPGDVPDGNAHRWGVPLPWWTPEGVRVRGAALERAGLQAPVLFPERLVLVR
ATRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcgcaccgccccctctccggcggctccgacctcccccacctgcgcgccgccggg
gtgagcctcctgctggacctgaccggccagaccctgccccgggtcctgcactggggttcg
gacctgggcgacctctcccgcggggagctggacgacctgcgcctggcgctgagcccgcag
cccatcgggttctccgtggacgggccggtggaggtggccgtgctccccgagcagtccgcc
ggctggctcggcacgccgggcctggtcggcaaccggggcggcgccgacttctccaccgcc
ttccgcgtgcgcgagtccgcggtggagcaccgctccccggcgggcgggcgcctgaccgta
cgcgccgaggacgcccgggccgggctctccctggacctcgtggtcgagctgaccccctcg
ggcctggtccgccagcgagccaccgtcaccaacggggccgcgtcccccttcgccgtggac
gccgtcaacctcgtcctccccgtcccggccgaggcggtcgagctgctcgacttcggcggg
cgccacatgcgcgagcgcagcccgcagcggaccgccttcacccagggcttgcgggtgcgc
gagaaccgtaccgggcgcaccggttacgacgcggcccacctgctggccgcggggacgcac
ggctccggcaaccgctccggcgaggtgtgggccgtgcacacggcctggtcgggcaaccac
cgcaccttcgccgagcgcacctaccacgcggtgtccctgctgggttcgggcgagctgctg
ctctccggggaggtcgtgctggccgagggggagtcctacaccaccccgtggcagtacggc
tcgcacgggcacgggctggacgaggtctccgcccgcttccaccggcacctgcgctcgcgc
ccgcaccacccctccaccccgcgcccggtggtcgtcaacacctgggaggccgtctacttc
gaccacggcctcgaccggctgcgcgagctggccgacgccgccgcccgcgtgggcgccgag
cggttcgtgctcgacgacggctggttcggctcgcgccgcgacgaccggcgcggcctcggc
gactggtacgtctccgacgaggtgtggccggacgggctgggcccgctcaccgaccacgtc
accgggctcggcatgcagttcgggctgtgggtggagccggagatggtcaacgaggactcc
gacctggcccgcgcgcacccggactggatcatggccgcgggcgaccggctgccccggccg
gcgcgctcccagcaggtgctcgacctggcccgtccggaggcgttcgcgtacgtcctggag
cgcctggacgacctgctgtccgcctacccggtctcctacctcaagtgggaccacaaccgg
gacctggtcgacgcggggcaccggccgaccgggcgggccggggtccacggccagaccctg
gcggtgtaccggctgatggacgaactgcgccgccgccacccggctgtggagatcgagtcc
tgttcgtccggcggcggacgggtggacctgggggtgctggagcgcaccgaccgcgtgtgg
gtctccgactgcatcgacgccctggagcggcaggacatccagcggtggaccaacgcgctc
gtcccgctggagctgatgggcacccacgtgggggcgggcaccgcgcacaccaccgaccgc
cgccacaccgtcgacttccgggccgggaccgccctgttcgggcacttcgggatcgaatgg
gacctcacccgcgccgaccccgccgacctggcccgcctgcgggagtgggtggagctgtac
aaggagctgcgcggcttgctgcacacggggaccgccgtgcacggcgaccacccggacccg
gcggtccgggtgcacggggtggtcgccgaggacggttccgaggcgctctacgcgatcgtc
gccacgggaacctcggagctgtacccgaccgggcccgtccggttgccgggcctgcgcccg
gaggcggtctaccgggtccgcccgcaggcgcccggggacgtgcccgacggcaacgcgcac
cggtggggggtgccgctgccctggtggacccccgagggcgtccgcgtcaggggcgcggcg
ctggagcgcgcgggcctccaggcgccggtgctcttcccggaacggctggtcctggtgcgc
gccacccggctctga

DBGET integrated database retrieval system