KEGG   Nocardiopsis dassonvillei: Ndas_4826Help
Entry
Ndas_4826         CDS       T01248                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nda00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nda00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nda00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(5718193..5720367)
Genome map
AA seq 724 aa AA seqDB search
MASHRPLSGGSDLPHLRAAGVSLLLDLTGQTLPRVLHWGSDLGDLSRGELDDLRLALSPQ
PIGFSVDGPVEVAVLPEQSAGWLGTPGLVGNRGGADFSTAFRVRESAVEHRSPAGGRLTV
RAEDARAGLSLDLVVELTPSGLVRQRATVTNGAASPFAVDAVNLVLPVPAEAVELLDFGG
RHMRERSPQRTAFTQGLRVRENRTGRTGYDAAHLLAAGTHGSGNRSGEVWAVHTAWSGNH
RTFAERTYHAVSLLGSGELLLSGEVVLAEGESYTTPWQYGSHGHGLDEVSARFHRHLRSR
PHHPSTPRPVVVNTWEAVYFDHGLDRLRELADAAARVGAERFVLDDGWFGSRRDDRRGLG
DWYVSDEVWPDGLGPLTDHVTGLGMQFGLWVEPEMVNEDSDLARAHPDWIMAAGDRLPRP
ARSQQVLDLARPEAFAYVLERLDDLLSAYPVSYLKWDHNRDLVDAGHRPTGRAGVHGQTL
AVYRLMDELRRRHPAVEIESCSSGGGRVDLGVLERTDRVWVSDCIDALERQDIQRWTNAL
VPLELMGTHVGAGTAHTTDRRHTVDFRAGTALFGHFGIEWDLTRADPADLARLREWVELY
KELRGLLHTGTAVHGDHPDPAVRVHGVVAEDGSEALYAIVATGTSELYPTGPVRLPGLRP
EAVYRVRPQAPGDVPDGNAHRWGVPLPWWTPEGVRVRGAALERAGLQAPVLFPERLVLVR
ATRL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcgcaccgccccctctccggcggctccgacctcccccacctgcgcgccgccggg
gtgagcctcctgctggacctgaccggccagaccctgccccgggtcctgcactggggttcg
gacctgggcgacctctcccgcggggagctggacgacctgcgcctggcgctgagcccgcag
cccatcgggttctccgtggacgggccggtggaggtggccgtgctccccgagcagtccgcc
ggctggctcggcacgccgggcctggtcggcaaccggggcggcgccgacttctccaccgcc
ttccgcgtgcgcgagtccgcggtggagcaccgctccccggcgggcgggcgcctgaccgta
cgcgccgaggacgcccgggccgggctctccctggacctcgtggtcgagctgaccccctcg
ggcctggtccgccagcgagccaccgtcaccaacggggccgcgtcccccttcgccgtggac
gccgtcaacctcgtcctccccgtcccggccgaggcggtcgagctgctcgacttcggcggg
cgccacatgcgcgagcgcagcccgcagcggaccgccttcacccagggcttgcgggtgcgc
gagaaccgtaccgggcgcaccggttacgacgcggcccacctgctggccgcggggacgcac
ggctccggcaaccgctccggcgaggtgtgggccgtgcacacggcctggtcgggcaaccac
cgcaccttcgccgagcgcacctaccacgcggtgtccctgctgggttcgggcgagctgctg
ctctccggggaggtcgtgctggccgagggggagtcctacaccaccccgtggcagtacggc
tcgcacgggcacgggctggacgaggtctccgcccgcttccaccggcacctgcgctcgcgc
ccgcaccacccctccaccccgcgcccggtggtcgtcaacacctgggaggccgtctacttc
gaccacggcctcgaccggctgcgcgagctggccgacgccgccgcccgcgtgggcgccgag
cggttcgtgctcgacgacggctggttcggctcgcgccgcgacgaccggcgcggcctcggc
gactggtacgtctccgacgaggtgtggccggacgggctgggcccgctcaccgaccacgtc
accgggctcggcatgcagttcgggctgtgggtggagccggagatggtcaacgaggactcc
gacctggcccgcgcgcacccggactggatcatggccgcgggcgaccggctgccccggccg
gcgcgctcccagcaggtgctcgacctggcccgtccggaggcgttcgcgtacgtcctggag
cgcctggacgacctgctgtccgcctacccggtctcctacctcaagtgggaccacaaccgg
gacctggtcgacgcggggcaccggccgaccgggcgggccggggtccacggccagaccctg
gcggtgtaccggctgatggacgaactgcgccgccgccacccggctgtggagatcgagtcc
tgttcgtccggcggcggacgggtggacctgggggtgctggagcgcaccgaccgcgtgtgg
gtctccgactgcatcgacgccctggagcggcaggacatccagcggtggaccaacgcgctc
gtcccgctggagctgatgggcacccacgtgggggcgggcaccgcgcacaccaccgaccgc
cgccacaccgtcgacttccgggccgggaccgccctgttcgggcacttcgggatcgaatgg
gacctcacccgcgccgaccccgccgacctggcccgcctgcgggagtgggtggagctgtac
aaggagctgcgcggcttgctgcacacggggaccgccgtgcacggcgaccacccggacccg
gcggtccgggtgcacggggtggtcgccgaggacggttccgaggcgctctacgcgatcgtc
gccacgggaacctcggagctgtacccgaccgggcccgtccggttgccgggcctgcgcccg
gaggcggtctaccgggtccgcccgcaggcgcccggggacgtgcccgacggcaacgcgcac
cggtggggggtgccgctgccctggtggacccccgagggcgtccgcgtcaggggcgcggcg
ctggagcgcgcgggcctccaggcgccggtgctcttcccggaacggctggtcctggtgcgc
gccacccggctctga

DBGET integrated database retrieval system