KEGG   Nocardiopsis dassonvillei: Ndas_4910Help
Entry
Ndas_4910         CDS       T01248                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ndas_4910
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ndas_4910
   00600 Sphingolipid metabolism
    Ndas_4910
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Ndas_4910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:40569..42716
Genome map
AA seq 715 aa AA seqDB search
MTHRTISLRAAGTALVLAVPEAGLPHVLHWGADLPDAEGLAAAAAPSAAHNDVDQPRRLS
LVPVQGEGWRGHPGISGHHEGRVTFPEWTVREVLADPLEDAAPGVGGALTVLAEAAGIAL
RCELRMEASGLVRARNTVTNTDAAPWTLDALRVTLPLPREAGEVLDLTGRWCRERSPQRQ
ELATGTRLRASRRGRTGHDAALVLAAGTPGFGFRHGEVWGVHTAWSGDHVHLAERLPEGA
GQADAVLAGGELLHPGEVRLDRGASYSTPWVFLSWSDRGLDGLSARIHRWLRARPGHPST
PRPVVLNTWEAVYFDHDLATLRRLADTAARIGVERFVLDDGWFRGRRDDTAGLGDWTVDT
GVWPGGLHPLFDHVRSLGMQVGLWVEPEMVNPDSDLARAHPEWFLAAEGRPAPPSRHQQL
LDLSRPEAFRYVFEHLDALVTEYRPDYLKWDHNRDLLEPVHAPTGAAGTHRQTLAVYALL
DRLRAGHPGLEIESCSSGGGRVDLGILERTDRVWASDTNDPLERLAVQRWTSLLLPPELV
GSHVGGRTAHTTGRDADLSFRCLASLLSHAGIEWDVTRCTDDELAALTSWIALYKELRPL
LHSGEAVHADAPDPAEQLDGVVAPDGSEAVFRYARLATSVRALPGRVRLPGLREDRVYRL
TWRPEAGTPSTTQRVLPEWFASGGATVSGAVLTRSGVQLPNLNPSQALLLHLREA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccgcaccatcagcctgcgcgcggcggggaccgccctggtcctcgccgtgccc
gaggccggactcccgcacgtcctgcactggggcgccgacctgcccgacgccgaggggctg
gccgccgccgcggcgccctccgccgcgcacaacgacgtcgaccagccccggcggctgtcc
ctggtgcccgtccagggggagggctggcgcggccaccccgggatctcgggccaccacgag
ggccgggtcaccttccccgagtggaccgtgcgcgaggtcctggcggacccgttggaggac
gccgcccccggcgtgggcggggccctcacggtcctggccgaggccgcggggatcgcgctg
cgctgcgagctgcgcatggaggcctccgggctggtccgcgcccgcaacacggtcaccaac
accgacgccgcgccgtggaccctggacgccctgcgggtcaccctgcccctgccccgcgag
gcgggcgaggtcctggacctgaccggccgctggtgccgtgagcgctccccccagcgacag
gaactggcgacgggcacccgcctgcgcgcctcgcgccggggccggaccgggcacgacgcc
gcgctggtcctggccgccgggacacccgggttcgggttccgccacggcgaggtgtggggc
gtgcacaccgcctggagcggcgaccacgtccacctggccgaacgcctgcccgagggcgcc
gggcaggccgacgccgtgctcgcgggcggcgaactgctccaccccggcgaggtgcgcctg
gaccggggcgcctcctactccaccccgtgggtgttcctctcctggtccgaccgggggctg
gacgggctgtccgcgcggatccaccgctggctgcgcgcccggcccggccacccctccacc
ccgcgcccggtggtgctcaacacctgggaggccgtctacttcgaccacgacctcgccacc
ctcaggcggctcgccgacaccgccgcgcggatcggcgtggagcggttcgtgctggacgac
ggatggttccggggccgccgcgacgacaccgccggactcggcgactggaccgtggacacc
ggcgtgtggcccgggggcctgcacccgctcttcgaccacgtgcgctccctgggcatgcag
gtcgggctgtgggtggagccggagatggtcaaccccgactccgacctggcccgcgcccac
cccgagtggttcctggccgccgaggggcgcccggccccgcccagccgccaccagcagctc
ctggacctgtcccgccccgaggccttccggtacgtgtttgagcacctggacgcgctggtc
accgagtaccggcccgactacctcaagtgggaccacaaccgcgacctgctcgaacccgtg
cacgcccccaccggcgccgccgggacgcaccgccagaccctggccgtctacgcgctgctc
gaccggctgcgcgccgggcaccccggcctggagatcgagtcgtgctcctccggcgggggc
cgcgtggacctggggatcctggagcgcaccgaccgcgtgtgggcctccgacaccaacgac
cccctggagcggctggccgtccagcgctggacctccctgctgctgccgcccgaactggtc
ggcagccacgtcggcggacgcaccgcgcacaccaccggccgcgacgccgacctgtccttc
cgctgcctggccagcctcctgtcccacgccgggatcgagtgggacgtcacccgctgcacc
gacgacgagctggccgcgctgacctcgtggatcgcgctgtacaaggaactgcgcccgctg
ctgcactcgggcgaggccgtgcacgccgacgcgcccgaccccgccgagcagctcgacggg
gtggtcgccccggacgggagcgaggcggtgttccgctacgcccggctggccacctccgtc
cgcgccctgccggggcgggtccggctgcccggcctgcgcgaggaccgcgtctaccgcctg
acgtggcggccggaggcgggtacgccctcgaccacgcagcgcgtgctcccggagtggttc
gccagcggcggggccaccgtgtcgggggcggtgctcacccgctcgggcgtgcagctgccc
aacctcaacccgtcccaagccctgctcctgcacctgagggaggcctga

DBGET integrated database retrieval system