KEGG   Nocardiopsis dassonvillei: Ndas_4911Help
Entry
Ndas_4911         CDS       T01248                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ndas_4911
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ndas_4911
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ndas_4911
Enzymes [BR:nda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Ndas_4911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:42718..45729
Genome map
AA seq 1003 aa AA seqDB search
MPAIRKPAYLEDFAPSEGTLAPRARFSSDAPSLDLNGTWRFRLLDRARADTDGFEEPGHD
DSDWSELPVPAHWQMHGHGAPAYTNISYPFPIDPPYVPDDNPTGDHRRVFDLPREWPEGA
AVLRFDGVDSCFRAWLNGTELGFSTGSRLAAEFEVGHLLRPGRNTLAVRVHQWSAASYLE
DQDMWWLSGIFRDVTLLARPADGVGDLAVSAAYDHTTGTGTLRVDVAGSADALVSVPELG
LVDAAAGVDHGVGAVEPWTAETPRLYDLEVRTPGERVRTRTGFRTVEVSGGLLRVNGRPL
LLRGVNRHEWHPDHGRAVPRETMREDVLLMKRHNVNAVRTSHYPPHPDFLDLCDELGLWV
VDECDLETHGFEEVGWRGNPSDDPRWREAYLDRMRRTVARDRNHPSVVLWSLGNESGTGE
NLRAMAEWTRAHDPSRPIHYEGDRDSAYVDVYSRMYAPHEEVDAIGRREEAPTADPAADG
HRRGLPFVLCEYGHAMGTGPGGLEEYQRLFEEHERCQGGFVWEWIDHGVRRREPDGTAWF
AYGGDFGEALHDGNFVADGLLLPDRTPSPGLEAYAKTVEPVRVVPDPAAGTVRVTNTWDF
RDTAGLAFVWRVEGEGIPLGEGPLDVPVLAAGESAEAVLPALPEPSGETWLTVSVRLAED
QPWAPAGHELAWGQAEVGAPGEPGAAAPGVPGGQEGTSASERSGALREPREPGDPGAWPG
AEGAVVLPASAGQDGIVRIGPGLLDAGTGALLSVGGLPVDAPAVDLWRAPTDNDVARHGD
SVAVPWRAAGLHRLTERLLSTGWEDGAFVVRTRLAPAAQEFGMRAAYRWGADGERLLLTV
EAEAEGEWPCPLPRFGVHVGLPASLGEAEWFGRGPGEAYRDVSQAARVGRFSSTVDGLQT
PYLRPQENGNRVDARWLALRAADGTGLRVEGDPVFDFTARRWDTAALDAADHPHELVPGD
RIHLHLDQAHQGVGSASCGPGVLPAHRLAAGSHRLRLALVPLG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccatccgcaagcccgcctacctggaggacttcgcgccctccgaggggaccctc
gcgccccgcgcccgcttctcctccgacgccccgtccctggacctcaacggcacgtggcgg
ttccggctgctcgaccgcgcgcgggccgacaccgacgggttcgaggagcccggccacgac
gactccgactggtccgaactgccggtgcccgcccactggcagatgcacggccacggcgcc
cccgcctacaccaacatctcctaccccttcccgatcgaccccccgtacgtgcccgatgac
aacccgaccggcgaccaccggcgcgtcttcgaccttccccgggagtggcccgagggggcg
gcggtcctgcgcttcgacggggtcgactcctgcttccgcgcgtggctgaacggcaccgag
ctgggcttctccaccgggagccgcctggccgccgagttcgaggtcggccacctgctgcgc
ccggggcgcaacaccctggcggtgcgcgtccaccagtggtcggcggccagctacctggag
gaccaggacatgtggtggctgtcggggatcttccgcgacgtcaccctcctcgcccggccc
gccgacggggtcggcgacctcgcggtgagcgccgcctacgaccacaccacgggcacgggt
accctgcgcgtggacgtggccggatccgccgacgccctggtcagcgttcccgaactgggg
ctggtggacgccgccgccggtgtggaccacggggtcggcgcggtcgagccgtggacggcc
gagacgccccgcctgtacgacctggaggtgcgcacaccgggggaacgggtccggacgcgg
acgggctttcggaccgtggaggtctccggcgggctcctgcgggtcaacggccgccccctg
ctgctgcggggcgtgaaccgccacgagtggcaccccgaccacggccgcgccgtgccccgg
gagaccatgcgcgaggacgtgctgctgatgaagcggcacaacgtcaacgccgtgcgcacc
agccactacccgccccacccggacttcctggacctgtgcgacgagctgggcctgtgggtc
gtggacgagtgcgacctggagacccacgggttcgaggaggtcggctggcgcggcaacccc
tccgacgacccgcgctggcgcgaggcctacctggaccggatgcgccgcaccgtcgcgcgc
gaccgcaaccaccccagcgtcgtcctgtggtccctgggcaacgagtccgggaccggggag
aacctgcgggccatggcggagtggacccgcgcacacgacccctcccggccgatccactac
gagggggaccgagacagcgcctacgtggacgtgtactcgcgcatgtacgcgccgcacgag
gaggtggacgccatcggccgccgggaggaggcgccgaccgccgacccggccgccgacggg
caccggcgcggactgccgttcgtcctgtgcgagtacgggcacgccatgggcaccggcccc
ggcgggctggaggagtaccagcggctcttcgaggagcacgagcgctgccagggcgggttc
gtctgggagtggatcgaccacggggtccgccgccgcgagccggacggcaccgcgtggttc
gcctacggcggcgacttcggcgaggccctgcacgacggcaacttcgtcgcggacggcctg
ctgctgcccgaccgcacgcccagtcccgggctggaggcctacgccaagaccgtcgaaccg
gtccgcgtggtccccgacccggccgccgggaccgtccgcgtcaccaacacctgggacttc
cgggacaccgcgggcctggccttcgtctggcgggtcgagggggaggggatccccctgggg
gagggccccctggacgtgccggtgctcgccgccggggagagcgccgaggcggtgctgccc
gcactgcccgagccgtccggggagacctggctgaccgtgtccgtccggctggccgaggac
cagccctgggccccggccgggcacgagctggcctggggacaggccgaggtgggcgccccc
ggggagccgggcgcggcagcgccgggggttccgggtgggcaggaagggacgagtgcgtcg
gagaggtcgggcgcgctgcgagagccgcgggagccgggggacccgggtgcgtggccgggg
gcggagggagctgtcgtgcttccggcgtccgccgggcaggacggcatcgtgcggatcggc
cccggcctgctggacgcggggaccggcgcgctgctctccgtgggcggcctgcccgtggac
gcgccggccgtggacctgtggcgcgctccgaccgacaacgacgtggcccggcacggggac
tccgtggccgtcccctggcgcgcggcggggctgcaccggctcaccgagcgcctgctgtcc
accggctgggaggacggcgcgttcgtcgtccgtacacggctggctccggcggcccaggag
ttcggcatgcgcgccgcctaccggtggggcgccgacggggagcgcctgctcctgaccgtg
gaggccgaggcggagggggagtggccctgcccgctgccgcgcttcggcgtgcacgtcggc
ctgcccgcctccctgggcgaggcggagtggttcggccgcggacccggggaggcctaccgg
gacgtgtcccaggccgcgcgggtcggccgcttctccagcacggtcgacggcctccagacg
ccctacctgcggccccaggagaacggcaaccgcgtggacgccaggtggctcgccctgcgg
gcggcggacgggacgggcctgcgggtggagggcgacccggtgttcgacttcaccgcgcgc
cgctgggacacggcggcgctcgacgcggccgaccacccgcacgaactggtccccggcgac
cggatccacctgcacctggaccaggcgcaccagggcgtgggctcggcctcgtgcggcccc
ggggtgctccccgcccaccgccttgcggccgggagccaccgcctccggctcgccctggtc
ccgctgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system