KEGG   Nocardiopsis dassonvillei: Ndas_4972Help
Entry
Ndas_4972         CDS       T01248                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00790  Folate biosynthesis
nda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ndas_4972
Enzymes [BR:nda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ndas_4972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF1471
Motif
Other DBs
NCBI-ProteinID: ADH70354
UniProt: D7B846
Position
2:113683..114585
Genome map
AA seq 300 aa AA seqDB search
MGPKHTLPGLPDRGRCLVMGVVNVTPDSFSDGGAWFDPDRAIEHGMRLAEEGADLVDVGG
ESTRPGAQRVSAAEELRRVEPVVRELSARGVAVSVDTMRAEIAEKAVEAGAVLVNDVSGG
LADPAMARLVASSGVAYVLMHWRGHSHDMQSRAVYTDVVQEVLDELRDRMEAMISAGVDP
GQIVLDPGLGFSKRPEQAHNWALLHELERFHELGRPVLVAGSRKRFLSRLLGDAKGEDRP
FTECDAATAAVTTLSADRGAWAVRVHDVRPSADAVRVAAAWSDGGARLDEGRAEPVEGRL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggggccgaaacacacacttccgggcctgcccgaccgcgggcggtgcctggtcatgggg
gtcgtgaacgtcacccccgactccttctccgacggcggcgcgtggttcgatcccgacagg
gcgatcgaacacgggatgcgcctggccgaggagggcgcggacctggtcgacgtaggcggt
gagtccacccgtcccggcgcgcagcgcgtctccgccgccgaggagctgcgcagggtcgaa
ccggtcgtgcgggagctctccgcgcggggcgtcgccgtcagcgtcgacaccatgcgcgcc
gagatcgccgagaaggccgtggaggccggggccgtgctggtcaacgacgtcagcggcggg
ctcgcagacccggccatggcccgactcgtggcttcttccggcgttgcctacgtgttgatg
cactggcgtgggcatagtcatgacatgcagagccgtgccgtgtacacggatgtcgtccag
gaggtcctcgatgagctccgcgaccgtatggaggccatgatcagtgcaggtgtcgacccc
ggacagatcgttctggaccccgggttgggattctccaagcgccccgagcaggcgcacaac
tgggcgctgctgcacgagctggagcgcttccacgagctggggcgccccgtgctggtggcc
ggatcgcgcaagcgcttcctgagccgcctgctcggcgacgccaagggcgaggaccgcccc
ttcaccgagtgcgacgccgccaccgcggccgtcaccaccctgtccgcggaccggggggcg
tgggccgtgcgggtgcacgacgtccgtcccagcgccgacgccgtccgcgtggcggcggcc
tggtccgacggcggcgcccgtctggacgagggacgcgccgagccggtggagggccgcctg
tga

DBGET integrated database retrieval system