KEGG   Nocardiopsis dassonvillei: Ndas_5161Help
Entry
Ndas_5161         CDS       T01248                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_5161
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_5161
   00052 Galactose metabolism
    Ndas_5161
   00500 Starch and sucrose metabolism
    Ndas_5161
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_5161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ndas_5161
   00524 Butirosin and neomycin biosynthesis
    Ndas_5161
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ndas_5161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:301306..302334
Genome map
AA seq 342 aa AA seqDB search
MADTRYGHALTIGVDIGGTKVAAGVVTPGGRILARLRTETPERSKSPAVVEDTIVSVVRE
LRREFRVRAVGVGAAGFVDERRANVLFAPHLSWRREPLREALALRLGLPVVVENDANASA
WAEVRAGAGRGVHNVVVVNLGTGIGGAVVLDGNLHRGRYGLAGEFGHMTVVPGGHRCECG
NRGCWEQYASGNALTREARELVASQSPVADALHQAVGGDAAQITGPLVSELARKGDRACV
ELMREAGQWLGSGLANLAAAFDPELFIVGGGVSEAGELLLEPAREAFGRNLTGRGYRPEA
RVAAAELGNEAGLIGAADLAREALPRWHQRRRQRRLGRFGRS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacacgcggtacgggcacgccctgacgatcggggtggacatcggcgggacgaag
gtcgccgccggtgtggtgacgcccggcgggcgcatcctggccaggctgcgcacggagacc
cccgaacgcagcaagagcccggcggttgtggaggacacgatcgtctcggtggtgcgggag
ctgcgccgggagttccgggtgcgcgccgtgggcgtgggcgccgccggtttcgtcgacgag
cggcgggccaacgtgctgttcgccccgcacctgtcctggcgccgggagccgctgcgcgag
gccctggccctgcggctggggctgcccgtggtggtggagaacgacgcgaacgcctccgcc
tgggccgaggtgcgcgccggggcgggccggggcgtgcacaacgtcgtggtggtgaacctg
ggcacgggcatcggcggtgcggtcgtgctcgacgggaacctgcaccggggccggtacgga
ctggccggggagttcgggcacatgacggtggtgccgggcggacaccgctgcgagtgcggg
aaccggggctgctgggagcagtacgccagcggcaacgcgctgacgcgggaggcgcgggag
ctggtggcctcgcagtcgccggtggcggacgccctgcaccaggcggtgggcggcgacgcc
gcccagatcaccggaccactggtcagcgagctggcgcgcaagggcgaccgcgcgtgcgtg
gagctgatgcgcgaggccgggcagtggctgggttcgggtctggccaacctggccgcggcg
ttcgacccggagctgttcatcgtgggcggcggcgtgtccgaggcgggggaactgctgctg
gagcccgcgagggaggcgttcgggcgcaacctcacggggcgcggctaccgtccggaggcc
cgggtggcggcggccgagctgggcaacgaggcgggcctcatcggcgccgcggacctggcc
cgggaggcgctgccccggtggcaccagcggcgccgacagcgccgcctggggcgtttcggc
aggagttag

DBGET integrated database retrieval system