KEGG   Nocardiopsis dassonvillei: Ndas_5161Help
Entry
Ndas_5161         CDS       T01248                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nda  Nocardiopsis dassonvillei
Pathway
nda00010  Glycolysis / Gluconeogenesis
nda00052  Galactose metabolism
nda00500  Starch and sucrose metabolism
nda00520  Amino sugar and nucleotide sugar metabolism
nda00521  Streptomycin biosynthesis
nda01100  Metabolic pathways
nda01110  Biosynthesis of secondary metabolites
nda01120  Microbial metabolism in diverse environments
nda01130  Biosynthesis of antibiotics
nda01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_5161
   00052 Galactose metabolism
    Ndas_5161
   00500 Starch and sucrose metabolism
    Ndas_5161
   00520 Amino sugar and nucleotide sugar metabolism
    Ndas_5161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ndas_5161
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ndas_5161
Enzymes [BR:nda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ndas_5161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADH70541
UniProt: D7B8N3
Position
2:301306..302334
Genome map
AA seq 342 aa AA seqDB search
MADTRYGHALTIGVDIGGTKVAAGVVTPGGRILARLRTETPERSKSPAVVEDTIVSVVRE
LRREFRVRAVGVGAAGFVDERRANVLFAPHLSWRREPLREALALRLGLPVVVENDANASA
WAEVRAGAGRGVHNVVVVNLGTGIGGAVVLDGNLHRGRYGLAGEFGHMTVVPGGHRCECG
NRGCWEQYASGNALTREARELVASQSPVADALHQAVGGDAAQITGPLVSELARKGDRACV
ELMREAGQWLGSGLANLAAAFDPELFIVGGGVSEAGELLLEPAREAFGRNLTGRGYRPEA
RVAAAELGNEAGLIGAADLAREALPRWHQRRRQRRLGRFGRS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacacgcggtacgggcacgccctgacgatcggggtggacatcggcgggacgaag
gtcgccgccggtgtggtgacgcccggcgggcgcatcctggccaggctgcgcacggagacc
cccgaacgcagcaagagcccggcggttgtggaggacacgatcgtctcggtggtgcgggag
ctgcgccgggagttccgggtgcgcgccgtgggcgtgggcgccgccggtttcgtcgacgag
cggcgggccaacgtgctgttcgccccgcacctgtcctggcgccgggagccgctgcgcgag
gccctggccctgcggctggggctgcccgtggtggtggagaacgacgcgaacgcctccgcc
tgggccgaggtgcgcgccggggcgggccggggcgtgcacaacgtcgtggtggtgaacctg
ggcacgggcatcggcggtgcggtcgtgctcgacgggaacctgcaccggggccggtacgga
ctggccggggagttcgggcacatgacggtggtgccgggcggacaccgctgcgagtgcggg
aaccggggctgctgggagcagtacgccagcggcaacgcgctgacgcgggaggcgcgggag
ctggtggcctcgcagtcgccggtggcggacgccctgcaccaggcggtgggcggcgacgcc
gcccagatcaccggaccactggtcagcgagctggcgcgcaagggcgaccgcgcgtgcgtg
gagctgatgcgcgaggccgggcagtggctgggttcgggtctggccaacctggccgcggcg
ttcgacccggagctgttcatcgtgggcggcggcgtgtccgaggcgggggaactgctgctg
gagcccgcgagggaggcgttcgggcgcaacctcacggggcgcggctaccgtccggaggcc
cgggtggcggcggccgagctgggcaacgaggcgggcctcatcggcgccgcggacctggcc
cgggaggcgctgccccggtggcaccagcggcgccgacagcgccgcctggggcgtttcggc
aggagttag

DBGET integrated database retrieval system