KEGG   Nocardiopsis dassonvillei: Ndas_5419Help
Entry
Ndas_5419         CDS       T01248                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nda00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ndas_5419
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ndas_5419
   00020 Citrate cycle (TCA cycle)
    Ndas_5419
   00620 Pyruvate metabolism
    Ndas_5419
Enzymes [BR:nda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ndas_5419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:599101..600504
Genome map
AA seq 467 aa AA seqDB search
MAISKNEPAVGGVQSFKLPDVGEGLVEAELLSWYVKPGDEVGVNQMICEIETAKAVVELP
SPFAGTVRELLAEEGQTVEVGAVIITVDDGSGGSAPEAAPSADSEEREKPLVGYGEKAAS
TQRRPRRRPGPSAPVSPPVPRVSEPAPANTPAVRETRAAPAPAPARAPGRPLAKPPVRKL
AKDLGVDLASVTPTGDNGVVTREDVRAAVGQAPGGPAAAETVQAAPAAAVDRTARERRVP
VKGVRKHTAAAMVGSAFTAPHVTEFLQVDVTRTMKAVARLRERPDFADVRVSPLLLVAKA
LLMAVRRHPEVNASWDEENQEIVVKDYVNLGIAAATERGLVVPNIKDADAMTLPELAAGL
KRLTETARAGKTSPADMSGGTITITNVGVFGVDAGTPILNPGEAAILAFGQIRDMPWVHK
GKLKVRKVTTLSLSFDHRLVDGELGSKVLRDIGTALEDPELTALAWG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttccaagaacgaacccgccgtcggcggagtgcagtcgttcaagctgcccgac
gtcggggagggcctggtcgaggccgaactcctctcctggtacgtcaagccgggtgacgag
gtcggggtcaaccagatgatctgcgagatcgagaccgccaaggcggtcgtcgagctcccc
agcccgttcgcggggacggtgcgcgagctgttggccgaggagggccagaccgtggaggtc
ggcgcggtgatcatcaccgtggacgacggctccggcggttccgccccggaggccgccccg
tcggcggactccgaggagcgggagaagccgctggtcggctacggcgagaaggcggcctcc
acccagcgccgaccgcgccgccgcccgggcccctcggcgccggtgtcgccgcccgtgccg
cgcgtcagcgagcccgcgcccgccaacacgcccgcggtgcgggagacgcgggcggccccg
gcccccgccccggcgcgggcgccgggccgtccgctcgccaagccgccggtgcgcaagctg
gccaaggacctcggcgtggacctggcgtcggtcacccccacgggggacaacggcgtcgtc
acccgcgaggacgtgcgggccgcggtcggtcaggctccggggggcccggcggccgcggag
accgtgcaggccgcccccgcggcggccgtggaccgcaccgcgcgcgagcggcgcgtgccc
gtcaagggcgtgcgcaagcacacggccgcggcgatggtcggcagcgcgttcaccgctccg
cacgtcaccgagttcctccaggtggacgtcaccaggacgatgaaggcggtcgcgcgcctg
cgcgagcggcccgacttcgccgacgtgcgggtgtccccgctgctgctggtcgccaaggcc
ctgctcatggcggtccggcggcacccggaggtcaacgcctcctgggacgaggagaaccag
gagatcgtggtcaaggactacgtgaacctggggatcgcggcggccaccgagcgcggtctg
gtggtgcccaacatcaaggacgccgacgccatgaccctgccggagctggcggcggggctg
aagcggctgaccgagaccgcccgggcgggcaagaccagcccggcggacatgtccggcggc
accatcacgatcaccaacgtcggcgtgttcggcgtggacgcgggcaccccgatcctcaac
ccgggtgaggcggccatcctcgccttcgggcagatccgggacatgccctgggtgcacaag
ggcaagctcaaggtccgcaaggtgacgaccctgtcgctgtccttcgaccaccgcctggtc
gacggggagctgggctccaaggtgctgcgcgacatcggcacggcgctggaggacccggag
ctgaccgccctggcctggggctag

DBGET integrated database retrieval system