KEGG   Nocardiopsis dassonvillei: Ndas_5559Help
Entry
Ndas_5559         CDS       T01248                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
nda  Nocardiopsis dassonvillei
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nda00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nda00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(755050..756207)
Genome map
AA seq 385 aa AA seqDB search
MSSYQPVPADRFTFGLWTVGWRGVNTFGDPVRPALDPVDAVRRLADLGAHGITFHDDDLI
PPGSSDTEREDILKRFRAALDETGLKVPMATTNLFSDPVFRDGGFTSNSRDVRRYAIRKV
IRNIELAVSLGAETYVCWGGMDGAETEAGKNDHAALDRLREAFDILCGYVREQGHDLRFA
LEPKPNEPRGDILLPTVGHALAFINELEHPEMVGVNPEVGHEQMAGLNFAHGVAQALWAG
KLFHIDLNGQRGIKYDQDLRFGSGDVKEAFFLVDLLESAGYDGPLHFDFKTPRTEDMSGV
WESAAACMRNYLILKEKARAFRADPEVVESLAASRVPELSQSTLGEGESLSDLLAEEIDL
AEVGERGYHFERLDQLAMEHLFGLR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctaccagcccgtgcccgcggacaggttcaccttcggtctgtggaccgtgggg
tggcgcggggtgaacaccttcggcgaccccgtccgcccggcgctcgacccggtggacgcc
gtccgccgcctcgccgacctcggcgcgcacgggatcaccttccacgacgacgacctcatc
ccgcccggcagctccgacaccgagcgcgaggacatcctcaagcggttccgcgcggccctg
gacgagaccgggctcaaggtgccgatggcgaccaccaacctgttctcggacccggtgttc
cgcgacggcgggttcacctccaacagccgcgacgtgcgccggtacgccatccgcaaggtc
atccgcaacatcgagctggccgtgtcgctgggcgccgagacctacgtgtgctggggaggc
atggacggcgccgagaccgaggcgggcaagaacgaccacgccgccctggaccggctgcgc
gaggccttcgacatcctgtgcggctacgtgcgcgagcagggccacgacctgcgcttcgcc
ctggagcccaagcccaacgagccgcgcggcgacatcctgctgcccacggtggggcacgcc
ctggccttcatcaacgagctggagcaccccgagatggtgggggtcaacccggaggtcggc
cacgagcagatggccgggctgaacttcgcgcacggcgtcgcgcaggccctgtgggcgggc
aagctcttccacatcgacctcaacggccagcgcgggatcaagtacgaccaggacctgcgc
ttcggctcgggcgacgtcaaggaggcgttcttcctggtggacctgctggagagcgcgggc
tacgacggcccgctgcacttcgacttcaagacgccgcgcaccgaggacatgagcggcgtg
tgggagtcggccgcggcctgcatgcgcaactacctcatcctcaaggagaaggccagggcg
ttccgcgccgaccccgaggtggtggagtcgctcgcggcctcgcgcgtgcccgagctgtcc
cagtccacgctgggcgagggcgagtccctgtccgacctgctggccgaggagatcgacctg
gccgaggtcggtgagcggggctaccacttcgagcgcctggaccagctcgccatggagcac
ctgttcggcctgcgctga

DBGET integrated database retrieval system