KEGG   Candidatus Nitrospira defluvii: NIDE0057Help
Entry
NIDE0057          CDS       T01281                                 

Gene name
ccpA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nde  Candidatus Nitrospira defluvii
Brite
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     NIDE0057 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48673..49746
Genome map
AA seq 357 aa AA seqDB search
MGKMRIKWVVGTVVVATVGAIGLAATRVMGEPSVGQPGAVPAAQEVPLGLEDPGGYIPAD
NPQTARKIELGRWLFFDKRLSKNGTVACATCHMPGLAFTDGQPVSTGIYRLQGGRSAPTA
INRVYSKAQFWDGRADTLEDQSVGPFVSPVEHGFLDHNELVGKIKSIEGYRALFQEVFGR
EVTVGDVGRAIAGFQRTLLSGNSPVDRFDMGGEEQALSDSAKRGLELFRGKARCTRCHSG
FNFSDEKFHNLGIGWDTNTVDLGRYMVTKNAEDIGAFKTPTLREIARTAPYMHDGRFATL
EDVVRFYNQGGIKNPHLDNTVIPLELTEPEQQDLVAFLRSLNGEGWQHVAAPVEFPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatgagaatcaagtgggtggtcggtaccgtggtggtggcgaccgtcggggcg
atcggcttggcggctaccagggtcatgggtgagccgtcggtggggcaaccaggcgccgtt
cctgcggcgcaggaggtgccgctgggcttggaggatcccggcggatatattcccgcggac
aacccgcagacggcgcggaagatcgaattggggcgctggctctttttcgacaagcggctc
tcgaagaacggaacagtggcgtgcgcaacctgtcacatgccgggcctggcattcaccgat
ggacagccggtctcgacgggtatttaccggttgcagggcggacgcagcgccccgacggcg
atcaaccgggtgtacagcaaggcgcaattctgggacggtcgagccgacacgttggaggat
caatcggtcggtccgttcgtcagcccggttgagcacgggtttctcgaccacaatgagttg
gtgggcaagatcaagagcattgagggctatcgtgcgctctttcaggaggtgttcggccgc
gaagtgaccgtcggcgatgtgggccgcgcgatcgccggctttcagcggaccctgttgtcg
ggcaacagcccggtggaccggttcgatatgggcggtgaagagcaggccttgagcgattcg
gcgaagcgagggctcgaactgtttcgagggaaggcccgctgcacacgttgtcactcgggg
ttcaacttctccgacgagaaatttcacaacctcggtatcggatgggatacgaacaccgtc
gatttgggacgctacatggtgacgaagaatgccgaggatatcggcgcgtttaaaacgccc
acgttgcgggagatcgcgcgcacggcgccgtacatgcacgatggacggtttgcgacgctc
gaggatgtggtccggttctataaccagggcggtatcaagaatccacatctcgacaatacc
gtgatcccgctcgaactgaccgaaccggagcagcaggatctggtggcgttcttacggtcg
ctcaacggcgaagggtggcagcacgtggctgcgcccgtagagtttccgaagtaa

DBGET integrated database retrieval system