KEGG   Candidatus Nitrospira defluvii: NIDE0246Help
Entry
NIDE0246          CDS       T01281                                 

Gene name
nagZ
Definition
beta-N-acetylglucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NIDE0246 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    NIDE0246 (nagZ)
Enzymes [BR:nde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NIDE0246 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215622..216773
Genome map
AA seq 383 aa AA seqDB search
MTLREQIGQLFMMGFTGTTVTKDLASFLAASKPGGVIFFRRNLESVQQIVDLTNGLQKLS
PAQPLLIAIDQEGGRVSRLPAEFTIFPPCGQLGQCNSSELAYSAAATIAKELRAVGINMN
MAPVLDVNSNPDNPVIGDRAFGAAPELVGEMGLATIGGLQDNMVVACGKHFPGHGDTATD
SHKELPVVDAGLHRLRETEFPPFQQAIRYGVSSLMTAHVLYRALDPEAPATLSSAVIERL
LREEFRYEGVVFTDDLEMHAIIDHDGIGEAAVRSFVAGCDVLLICKDQDRVMTAMQAMER
AVNDGRITQDRLAQSLARVAKLKARYLHPYKPVTISDARLVVGCRSHKVLLDSWHKAYAR
IPQPKSVETVQATSSHDSPVTHV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacattacgcgagcagatcggtcagctgtttatgatgggcttcaccgggaccacggtc
accaaagacctggcctcgtttctggcagcctccaagccgggcggcgtcatctttttccgt
cgcaatctcgagtcggttcagcagatcgtcgatctcaccaacgggctgcagaaactgtcg
cccgctcagccgctgctgatcgcgattgaccaggagggcggccgggtgtcccggttgccg
gccgaatttacgattttccctccttgcggacagctggggcagtgcaactcgagtgaattg
gcctactccgctgccgcgacgattgccaaagagttgcgggcagtggggatcaatatgaac
atggcgccggtgctggacgtgaacagcaatccggacaatccggtcatcggcgatcgggcg
ttcggcgctgctcccgagcttgtcggagaaatggggctggcgaccatcggagggctgcag
gacaatatggtggtcgcgtgcgggaagcacttccctggccatggcgacacggcgacggat
tcccacaaggagctgccggtggtcgatgccggacttcatcgattgcgtgagacggagttt
cctccctttcaacaggccattcgttatggcgtatccagcttgatgacggcccatgtgctc
tatcgggccttggacccggaggcgccggcaaccctgtcctctgcggtgatcgagcgcttg
ctgcgcgaggagttccgatatgagggtgtggtctttaccgacgatctggagatgcatgcc
attatcgatcacgacgggattggcgaagcggctgttcggtcgtttgtggccggatgcgac
gttttgttgatctgcaaggaccaggatcgtgttatgaccgccatgcaggctatggagcgt
gccgtgaacgatggtcgaatcacccaggacagactggcgcagtcgctggcccgcgtggcc
aagctcaaggcacggtatctccatccctacaagccggtcacgatctccgatgcgcggctg
gtggtcgggtgccggtcgcacaaagtcctgctcgattcatggcacaaggcctatgcgcgt
attccccaacccaagtcagtcgagacggtgcaagccacatcctcacatgattctccggta
acgcacgtgtga

DBGET integrated database retrieval system