KEGG   Candidatus Nitrospira defluvii: NIDE0280Help
Entry
NIDE0280          CDS       T01281                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NIDE0280 (recR)
DNA repair and recombination proteins [BR:nde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NIDE0280 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
249448..250050
Genome map
AA seq 200 aa AA seqDB search
MSVDQQGLLAKLVRELVRLPGIGQKSAQRLAFHLLKAEREDAMRLAEAIQAVKDGLSFCR
QCRNIAEGELCEFCRDPKRDRSKILVIEEPSTLYAIERAGGYRGLYHVLLGVLSPLDGVG
PSDIRAEELLDRVKAGGVEEVIVATNPTIEGEATAIYLTRLLKPHHVRVTRIAYGIPVGM
DIEYADEVTLVKSIEGRRDL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgatcagcagggtctgttagcgaagttagtgcgagagttggtgcgtctgccc
gggatcggtcagaaaagtgcgcaacggctggcctttcatctgctcaaggcggagcgggaa
gatgcgatgcgcctcgccgaggcgattcaggcggtgaaagacggactgtcgttctgccga
caatgccggaatattgccgagggggaactctgtgagttctgccgggatcccaagcgggac
cgcagcaagatcctcgtcattgaagagcccagcacgttgtacgccatcgaacgggccggc
ggctatcgaggcctgtatcacgtcctgctcggagtgctgtctcccctggatggcgtcgga
ccatcggacattcgtgccgaggagttgctggatcgagtgaaggcgggaggcgtggaagag
gtcatcgtggcgacgaatcccacgatcgagggtgaagcgaccgccatctacttgacccgg
ctcttgaagccgcatcatgttcgggtgacccgcatcgcttacggcattcctgtcgggatg
gatatcgagtatgcggacgaagtcaccctcgtgaaatcgatcgaaggccggagggatctc
tga

DBGET integrated database retrieval system