KEGG   Candidatus Nitrospira defluvii: NIDE0354Help
Entry
NIDE0354          CDS       T01281                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE0354 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE0354 (glk)
   00052 Galactose metabolism
    NIDE0354 (glk)
   00500 Starch and sucrose metabolism
    NIDE0354 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NIDE0354 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIDE0354 (glk)
   00524 Butirosin and neomycin biosynthesis
    NIDE0354 (glk)
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NIDE0354 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(317067..318152)
Genome map
AA seq 361 aa AA seqDB search
MILAGDIGGTKTNLALYDWTTERVEPVREDSFHSADYKTLEEIIEEFLSAPLPKPPAEDE
PGNEPVEAPAEETTEAPELPPEPIKLTAACFGVAGPVIDNRCRTTNLPWVIDGATLAERF
AIPQVRLLNDLEATAHGLLLLNPDEIVVLNAGAPPKKKQALALIAAGTGLGECILYWDGT
RYRPMPSEGGHTDFAPNSDSEIDLLRHLRGSYLHVSYERIVSGPGLHAIYEYLRDTKKNE
PTWLAEKIKVGNPAAEIADAGLKGQAEIAKQTLDLFASIYGAEAGNLALKALTLDGVYVA
GGIAPKLLKKLQDGSFMRGFTNKGRYKRIMSQIPVKVVMNDKTALLGAASTAAQLSSSAS
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcaggcgatatcggaggcacaaaaaccaatctggcgctctacgactggacg
actgaacgggtcgagccggtgcgggaagatagcttccatagcgcggactataagaccctc
gaagaaatcatcgaagaatttctcagtgcaccgttgcccaagcccccggcagaagacgag
ccgggaaacgagcccgtcgaagcgccggcagaagaaactacggaggcaccggagcttccc
ccagagcctatcaaattaacggcggcgtgcttcggcgtggcaggaccggtgatcgataac
cgttgccgcaccacaaatcttccctgggtcattgatggagcgacacttgcggaacgattc
gccatcccccaagtgcgcctgctcaacgatctcgaagcaacggcccatggcctcctcctc
ctcaatcccgatgaaatcgtggtgctgaacgccggcgccccgccgaagaaaaaacaggcc
ctcgccttgatcgcggccggtaccggtctcggtgaatgcattctctattgggatggaact
cgctaccgccccatgccgtcggaaggcgggcatacggacttcgccccgaacagcgacagc
gaaatcgacttgcttcgccatctgcgtggcagctacctgcacgtgagttacgaacgcatc
gtatccgggccgggccttcatgccatctacgaatatctccgcgacaccaagaaaaatgag
ccgacctggttggcggagaagatcaaagtcggcaatcccgccgccgagattgccgatgcc
ggactcaagggacaggccgaaatcgccaaacagacccttgatttatttgcgtccatttac
ggtgcggaagccggcaacctggcgctcaaggcgcttacactcgacggagtctatgtcgcc
ggcgggatcgcgcccaaattgctgaagaagctgcaggacggctcgtttatgcgcggattc
accaataagggccgttacaaacggatcatgagccagatcccggtgaaggtcgtgatgaac
gacaaaaccgctctgctcggcgccgcctcgacggcggcacaactctcatcatcggcctca
gcatga

DBGET integrated database retrieval system