KEGG   Candidatus Nitrospira defluvii: NIDE0416Help
Entry
NIDE0416          CDS       T01281                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NIDE0416 (ruvA)
Enzymes [BR:nde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NIDE0416 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377697..378305
Genome map
AA seq 202 aa AA seqDB search
MIALLTGLMAFKAPSQVTLDVHGVGYEVLIPLSTYYSLPNQHESVTLSIHTHVREDAIQL
YGFLTTAEKEAFLLLTGISGIGPKLGLSVLSTLSVRDLFSAIQAGDIEKLGTVSGIGKKS
AARIALELKDKVARLYPAGEQSTSGSGQPAHPLYDDALSALVNLGYRQPDVKEALKRIEK
SGAMAQGLEGVIREALKDLAKG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttactgacgggcctcatggccttcaaggcgccttcgcaagtcacgctcgat
gtgcatggcgtcggctacgaagtgttgattcccctcagtacctactattctctccccaat
cagcatgagtcggtcacgctcagcatccatactcacgtgcgtgaggatgcgattcagctg
tatgggttcctgaccaccgcggagaaggaagcctttctactgttgacgggaatctccggc
atagggcccaaattgggattgagcgttctgtccaccctctcggtccgcgatctcttttcc
gccatccaggccggtgatattgagaagctaggcacagtatccggcatcgggaaaaaatct
gcggcgaggattgcgctggaattgaaggacaaggttgcgcgattgtatccagcgggcgaa
cagagcacgtcggggagcggacagcctgcacatccgctctatgatgatgcgctgtcagcc
cttgtgaatttgggctatcggcaaccggatgtgaaagaagcgttgaagaggattgagaag
tccggcgccatggcgcagggactggaaggtgtgattcgtgaggcactcaaagacctggcc
aaggggtga

DBGET integrated database retrieval system