KEGG   Candidatus Nitrospira defluvii: NIDE0700Help
Entry
NIDE0700          CDS       T01281                                 

Definition
putative dihydroflavanol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nde  Candidatus Nitrospira defluvii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667135..668118)
Genome map
AA seq 327 aa AA seqDB search
MKALVTGATGFVGGAVARALVKAGVEVRTLSRKGADLQNLAGLPVEQVHGDLRDRDSLRQ
ALRGCRQLYHVAAHYALWAKDPSIFYDINVTGTRTLLEAAREVGIERTVYCSTIGAIGLP
PGGGLGTEETPVSLEQMAGHYKRSKYLAEQEVLKLAREGLPVVIVNPSAPVGEADVKPTP
TGQIIVDFMKGRMPAYIETGMNLIDVDDVAQGHLLAMQKGRQGERYILGNKNLLLNEVFQ
ILSRITGVKAPTIKLPRLAILPLAFANQWISNLTGVAPRIPLEGVKMAKYKMHYDCSKAI
RELGLPQTPVEVALEKAVRWFRTHGYA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctcgtcaccggagcgacaggatttgtcggcggggctgtggcacgcgcgctg
gtgaaggccggcgtagaagttcggacactttcccgcaagggggccgatcttcagaacctc
gccggcctgccggtggagcaggtccacggagacctccgggatcgcgactctcttcgacaa
gccctacgcggctgccggcagctctaccacgtggcggcccattacgctctctgggcgaaa
gacccttccattttctacgacatcaacgtcaccggcacccgcaccctgctggaggcagcg
cgcgaggtcggcatcgagcggaccgtctactgcagcaccatcggcgcgatcggcctgccg
ccgggcggggggctgggaacggaagagacgccggtgtcgctggagcagatggccggccat
tacaaacgttccaaatatttggccgagcaggaagtgctgaagctcgcgcgcgaaggcctg
ccggtcgtcatcgtgaaccccagcgcgccggtcggcgaagcggatgtgaagcccaccccc
accggccagatcatcgtggacttcatgaagggccgcatgcccgcctacatcgaaaccggc
atgaacctgatcgacgtggacgacgtggcccaaggccacctgctcgccatgcagaaaggc
cggcagggcgaacgctacattctgggtaacaagaatctgctcctcaacgaagtgttccag
atcctcagccggatcaccggggtaaaggccccaaccatcaaactcccgcgcctcgccatt
ctgcccctcgcctttgcaaatcagtggatctcgaacctcacgggtgtggccccgcgcatt
ccgctcgaaggcgtgaagatggccaaatacaagatgcattacgactgcagcaaagcgatc
cgggagctaggcctgccgcaaacgccggtggaggttgccttggaaaaagcggtgcgatgg
ttccggacgcatggttacgcgtag

DBGET integrated database retrieval system