KEGG   Candidatus Nitrospira defluvii: NIDE0780Help
Entry
NIDE0780          CDS       T01281                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745160..746074
Genome map
AA seq 304 aa AA seqDB search
MNSTSLRVLTPAKVNLILRVLERRPDGFHAVWSLMHTVGLDDELTLTIQPGTTSRIALHC
DHAALAADQSNLVYRAAQLVLARIDRVVDLSITLTKRIPLGAGLGGGSSDAAATILGLTR
LLGLKWSIDQMSELGQQLGSDVPFFFVGPAACVTGRGEQVRAVQVTGARWIVLVNPGFPV
ETKWAYRQLSATRAAVRPLSTELQQLGTRAVVDWSEIIPLVENDFEAPVFSQHPVLARLK
SELLRQGAEVALLSGSGATMFGIFPGQADAERAAAVFARDPKMKTYAVPAAGIPVTSAVE
ARRP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctaccagcctgcgtgttctgacccctgcgaaggtgaatctgatcctccgtgtg
ctcgaacggcgtcctgacggctttcatgccgtctggtcgttgatgcacacggtcggactc
gacgatgagctgactcttacgatccagcccggcacgacttcccgcattgctttgcactgc
gaccatgccgcgctggcggccgatcagagcaatcttgtctatcgagccgcgcagctcgtg
ttggcgcgtatcgatcgagtcgtcgatctgtcgattaccctgacgaaacgcattccgctt
ggggccggcttggggggcggtagcagcgatgcggccgcgacgattctcggcctgactcgc
ctgctgggattgaagtggtcgatcgatcagatgtcggaattggggcagcagttgggcagc
gacgtgccgttcttttttgtggggccggctgcctgtgtcaccggtcgaggtgaacaggtg
cgagccgtgcaggtgacgggcgctcgctggatcgtgctggtcaatcccggctttcctgtc
gaaaccaagtgggcgtaccggcagctgtctgccaccagggcggcggtgcgtcctttgtcc
acggaactccagcaactgggcacccgtgctgtcgtggattggtccgagatcattcctttg
gtggagaatgattttgaggcgccggttttttcgcagcatccggtattggcccgactcaag
agcgaattgctgcgtcagggcgctgaggttgccctgttgtccgggagcggggccacgatg
ttcgggatatttcccgggcaggccgatgcggagcgggccgccgctgtgtttgcccgcgac
ccgaagatgaagacctatgccgtaccggcggcaggtattccggtcacgagcgcagttgaa
gcccgaaggccatag

DBGET integrated database retrieval system