KEGG   Candidatus Nitrospira defluvii: NIDE0824Help
Entry
NIDE0824          CDS       T01281                                 

Gene name
forC
Definition
2-oxoglutarate:ferredoxin oxidoredutase subunit gamma (EC:1.2.7.3)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE0824 (forC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE0824 (forC)
   00020 Citrate cycle (TCA cycle)
    NIDE0824 (forC)
   00620 Pyruvate metabolism
    NIDE0824 (forC)
   00640 Propanoate metabolism
    NIDE0824 (forC)
   00650 Butanoate metabolism
    NIDE0824 (forC)
  Energy metabolism
   00680 Methane metabolism
    NIDE0824 (forC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIDE0824 (forC)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIDE0824 (forC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
789752..790465
Genome map
AA seq 237 aa AA seqDB search
MATRFNIRMAGVGGQGVVTGSHILSTAVIHAGGESTIVPFYGSEKRMAPVESYVRVSDEP
IYEIGEITFPHIIIIFHPQVITHGKSYTMPFYFGLKENGIALINNDGPMKLHRDQARELE
ERHAKLYYFPATKLSLEVAGMDLATNMALMGCIGAITGLTSVEALEQSVKDRFLGKGFVV
SGGTAALDSVVERKFKKKQELIEKNVAVIRAGWNYAVDHGWAAPSVKRSEAAESVTA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcgacacggttcaatattcgtatggcgggtgtgggcggccagggcgttgtgaccggc
tcgcatattcttagtacggcggtcattcatgccggaggagaaagtacgatcgttccgttt
tacggatcagaaaagcgtatggcaccagtcgagagctatgttcgagtctcggatgagcct
atctatgaaatcggtgagatcaccttcccgcacatcatcatcatctttcacccgcaggtc
atcacgcacggcaagtcatacaccatgccgttctacttcgggttgaaggagaacgggatt
gccttgatcaataatgatggccccatgaagctccatcgcgaccaggcgcgtgagctcgaa
gagcgtcatgcgaaactgtattatttcccggctacgaaactttctttggaagtggcggga
atggacctcgccacgaacatggccttgatgggttgcatcggggctatcacagggctgacc
tctgtcgaggccttggagcaatcggtgaaagatcggttcctcgggaaaggttttgtggtc
tccggaggtactgcagcgctggacagcgtcgttgaacggaaattcaagaagaagcaagag
ttgatcgagaaaaacgtggcagttattcgcgccggctggaattatgccgttgaccatgga
tgggcggccccctctgtgaagcgttcggaagcggcggagagcgtcaccgcataa

DBGET integrated database retrieval system