KEGG   Candidatus Nitrospira defluvii: NIDE0833Help
Entry
NIDE0833          CDS       T01281                                 

Gene name
mutM
Definition
bifunctional DNA-formamidopyrimidine glycosylase/DNA lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nde03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
795929..796792
Genome map
AA seq 287 aa AA seqDB search
MPELPEAEVAARQLRERVVGATVRDCWIGREDIVREGLLSLEQYRQAKITGVERKGKSVI
LHFLCGKEPRFLVAELGMTGLLLFRSTSTKHPHHTHFVLHLDGCSEPDIRYWNPRRFGRL
SLLDQAGLERYVARRFGYDPLTISHEQFLCVLRATRSRLKSLLMHQQVIAGIGNIYANEI
LFRSCLHPNQPSNTIPEKSIVRLHQVMGEVLREAIAMGGSSVRDYFAPDGTEGQYKSRHL
VYAKAGEPCPNACGTVICRSVGERSSFYCPTCQRNGRRHATRPKKFH
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgccggaagccgaagtagccgcgcgtcaattgcgcgaacgggtcgtcgga
gccaccgtccgtgattgctggattggccgtgaggacatcgtgcgagaagggttgctttct
ctggaacagtatcgtcaggccaagattacaggggtcgagcgaaagggaaaaagcgtaatt
cttcactttctctgcggcaaggagccgagatttctcgtcgcagagttaggtatgacggga
ttattgctgttccgatccacctcgaccaagcatccccaccatacccacttcgtcctgcac
ctcgatggttgttctgagcccgatatcagatattggaatccgcgccggtttggtcgttta
tcgttgcttgaccaagcggggctggaacgatatgtcgctcgccggttcggctatgacccc
ctcacgatcagtcatgagcaatttttgtgtgtgctccgggcgacacggagtcggctgaag
tctctcctgatgcatcaacaagtgatcgcagggatcggtaacatctatgcaaatgagatc
ctcttccgttcctgcctccatcccaatcagccatcgaatacgattccagagaagtcgatc
gtacgcttgcatcaagtcatgggcgaggtgttacgggaagccattgccatgggagggtcg
agcgtgcgcgattattttgcgccggatgggaccgaaggccaatacaagagcaggcatctg
gtgtatgccaaggccggtgagccctgcccgaatgcctgcggtaccgtcatttgtcgctcc
gtcggcgaacgaagttcgttttactgtcccacatgccagcgaaacgggcgtcggcatgcc
acaaggcctaaaaagtttcactaa

DBGET integrated database retrieval system