KEGG   Candidatus Nitrospira defluvii: NIDE0834Help
Entry
NIDE0834          CDS       T01281                                 

Gene name
aclB
Definition
ATP-citrate lyase subunit beta (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE0834 (aclB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIDE0834 (aclB)
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     NIDE0834 (aclB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
796984..798183
Genome map
AA seq 399 aa AA seqDB search
MAKVLEGPGMGLMKKWGINVPNYVVVTSVDELSRLGQANEWLKKSKLVAKAHEALGSRFK
LGLVKIDLDFKAAEAATKEMIGRQVGSITVTQVIVSEMIPHKEEYYCAVKSTREGSEVLV
ANCGGIEVESNWERVKRLCLEIGQAPSPESLEKLSKEAGFSGPLAKKVAEFAGKMFACFD
SEDAQYLEVNPVVLRAADEELVALDAVTLLDGDAKFRHPDWNFAFAAEFGRAYSKQELEV
MAVDSKIKGSVKFIEIPGGDTAMLPAGGGASVYYSDAVVARGGKLANYAEYSGDPPDWAV
EVLTEKVCSLPGIRNIIVGGAIANFTDVKKTFGGIINGFRKAKSEGKLKNVKIWVRRGGP
REKEGLDAMRALKEEGFDINVFDRNTPLTDIVDKALQAK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagtgctggaaggtcccgggatggggctgatgaagaagtgggggattaatgtt
cccaattatgtggtcgtcacttccgttgatgagttgtccaggctcggtcaagccaatgaa
tggttgaagaaatccaagcttgttgcgaaagcgcacgaggctctcgggtcgcgcttcaag
ttggggcttgtgaagatcgacttggactttaaggcggcggaagccgctacgaaagagatg
atcggccgtcaagtcggcagcatcaccgtgactcaggtgattgtctctgagatgatcccg
cacaaggaagaatattattgcgcggtgaaatccacgcgcgaaggcagtgaggtcctggtt
gccaattgcggcgggatcgaagtcgaatcaaattgggaacgtgttaagaggctgtgtctt
gagatcggtcaagctccttctcctgaatccctcgaaaaactgtcgaaagaggcaggattt
agtgggccgctcgcgaagaaggtggctgagtttgcagggaaaatgtttgcctgcttcgac
agtgaagatgcgcaatatctcgaggtgaacccggtcgtccttcgtgctgccgatgaagag
ctggtggcgcttgatgccgtgacattgctcgacggcgatgccaaatttaggcatccggac
tggaatttcgcttttgcggcggaatttggtcgtgcttattccaagcaagagctcgaggtg
atggctgtcgatagcaaaatcaagggctcagttaaattcatcgaaatccctggtggggat
acagcgatgttgccggcgggtggcggtgccagcgtgtactactcagatgcggtcgtggcg
cgtggcggcaagctggccaattatgccgaatactccggtgatccacctgattgggccgtt
gaggtcctcacggaaaaagtctgttctttgccgggaatcaggaacatcattgtgggtggt
gcgatcgccaacttcaccgacgtgaagaagacgttcggagggatcatcaacggcttccgg
aaggcgaagtcggaagggaagttgaagaacgtaaagatttgggtgcgccgcggtgggccg
cgggaaaaagagggccttgatgcgatgcgtgcgttgaaagaagaaggctttgacatcaat
gtcttcgaccgcaatacaccgctcaccgacattgtcgacaaggcgctccaagcgaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system