KEGG   Candidatus Nitrospira defluvii: NIDE0971Help
Entry
NIDE0971          CDS       T01281                                 

Gene name
porA
Definition
pyruvate:ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE0971 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE0971 (porA)
   00020 Citrate cycle (TCA cycle)
    NIDE0971 (porA)
   00620 Pyruvate metabolism
    NIDE0971 (porA)
   00640 Propanoate metabolism
    NIDE0971 (porA)
   00650 Butanoate metabolism
    NIDE0971 (porA)
  Energy metabolism
   00680 Methane metabolism
    NIDE0971 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIDE0971 (porA)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIDE0971 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(949778..950989)
Genome map
AA seq 403 aa AA seqDB search
MAEIKSHIGTQNKKGQTYTDAWKMMHEAPRNPSFYTGSEVIKEALRRASCDVMIAYPITP
QSEAAALIGELFAEGYIGDYFRGESEFAVMSQCAGAAFGGARVFTTTAGPGTMRAMENFP
MWAGARLPIQMIVTCRGINSPLSIQPDTIEISYLLNTGMLVWHAETAQDFFDWILKGFMV
SEEPEVHLPLALCCDGFFVTHTKDVVNLTPADMCLPPYDPYRSPVPCMDMECPPVRMMRD
PFIMKSNYISYATHASWQQEIWAAIERSRKHTIKWINGLIDTENTDAEVVIVASGTAVSQ
GREAIRLLEDEGVRCGLVKVKSLRPWPGEEIREATKNAKHIFVPEFNVTGWLAKEIKATI
PNSERVHAGPHVCGGMTMPPEIIASEIKTALGLRSESLAGRGS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaataaaatcccacatcgggacacagaataaaaagggccagacatatacagat
gcgtggaagatgatgcacgaggcccctcgcaacccgtccttttacaccggcagcgaggtc
attaaggaggccctgcgtcgggcaagctgcgacgtcatgattgcctaccccattacgccg
caaagcgaggctgcagccctcatcggtgaattgttcgccgaaggctacatcggtgactac
ttccgcggcgagagcgagtttgccgttatgtcccaatgtgccggcgccgcctttggtggc
gcacgggtgttcacgacgaccgccgggcctggcacgatgcgcgcgatggaaaactttcct
atgtgggcgggtgcgcgtctgccgattcaaatgatcgtcacatgtcgaggcatcaactct
ccgctgtcgattcagccggatacgattgagatttcctacctgttaaatacaggcatgcta
gtttggcacgcagagacggcacaggacttcttcgattggatcctcaaaggcttcatggta
tcggaagaaccggaagtgcatttacctctggcgttatgctgtgacggcttctttgtgacc
catacgaaagacgtcgtgaacctcactccagccgatatgtgcctgcccccttacgatccc
taccgctcacccgtgccttgcatggacatggagtgtccgccggtccgaatgatgcgtgac
ccgttcattatgaagagcaactacatcagctatgccacccacgcttcctggcaacaagaa
atttgggcggcgattgaacgctcgcgcaagcacacgatcaagtggatcaatggcctgatc
gatacagaaaacactgatgctgaagtcgtgattgttgcgtcaggcactgcggtctcacag
gggcgagaagctatccgcctgctcgaagacgagggcgtgcgttgcggactggtgaaggtg
aagtcactccgcccctggcccggagaagaaattcgcgaggccacaaagaatgcaaaacac
atttttgtgccggagtttaacgtgacgggttggttagccaaagaaatcaaagccaccatc
cctaacagcgagcgtgttcatgccggcccgcacgtgtgtggcggaatgacgatgccgcca
gaaatcatcgcttcagagatcaaaacggctctaggcctgcgctccgagtcactcgctgga
agagggagctga

DBGET integrated database retrieval system