KEGG   Candidatus Nitrospira defluvii: NIDE1099Help
Entry
NIDE1099          CDS       T01281                                 

Gene name
proB
Definition
glutamat 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nde01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nde00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1070521..1071642)
Genome map
AA seq 373 aa AA seqDB search
MRDELLRQAKRVVIKIGSSLVASRETGLSAERIERLAGEIAEVRAQGREVLVVSSGAVVS
GIKKLGLREYPKSLPLKQAAAAVGQSLLMWAYEKAFERLTLRVAQVLLTHEDLADRRRFL
NARHTLTTLIKFGVIPIINENDTVAVEEIRVGDNDTLAAQVAHLVDADLLIILSDVDGLF
TVDPRKDPTASLIPLIPEITKDIEQRAGMSSTFEGTGGMATKVRAAKKVGEYGVATLILN
GTRTRLLPDVLSGQSGGSLFLARERRLTSRKHWIAFTLRPRGHVQLDQGAVEALVRNGKS
LLASGILDITGHFDAGDPVTCAGPDGKECAKGLVNFSSEILARIKGLKTADIQKIPGLQE
YEEVIHRDNLVIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagacgaactcctaagacaagccaaacgcgtcgtcattaagatcgggagcagcctg
gtcgcctcgcgtgaaaccggcctgagtgccgaacgtatcgagcgccttgccggcgaaatc
gccgaggtgcgggcgcagggacgcgaggtcctggtggtctcgtccggtgcggtcgtgtcc
ggcattaaaaaactcgggctgcgcgagtacccgaaaagcctgccgctcaaacaggccgct
gctgcggtcggccaaagcctcctcatgtgggcctacgagaaggcctttgagcgcctcact
ctccgggtcgcacaggtactgctgacccatgaagacctcgccgatcggcgacggtttctc
aacgcccgccacaccctcaccaccctgatcaaattcggggtgattccgatcatcaacgaa
aacgataccgtcgcggtcgaggaaatccgcgtgggagacaacgatacgctggcggcacaa
gtcgcccacctggtcgatgcggatttgttgatcatcctctcggacgtcgacgggctcttt
accgtggacccacggaaggatccgacggcctcattgattccgctgattccagagatcacc
aaagatatcgaacagcgggcaggcatgtcgtccaccttcgaaggcaccggcggcatggcc
accaaagtacgcgccgccaagaaggtgggggaatacggcgtcgccaccctgattctaaat
ggaacccggacacgactgcttccggacgtgctgtccgggcaatccggcggcagcctgttt
ctcgcccgggaacgacgcttgaccagtcgcaaacactggattgcgtttactctgcggccg
cgcggccatgtgcagctggatcagggagccgtcgaggccctggtacggaacggcaaaagc
ctcctggcatcgggcatcctcgatattaccggccatttcgacgccggcgatccggtgacc
tgcgccggtcctgacggaaaagaatgcgccaagggcctcgtcaatttctcctcagagatc
ctggctcgaatcaaggggctcaagactgccgacatccaaaaaatccccggtcttcaggag
tatgaagaggtcattcaccgcgacaacctggtgatcctctag

DBGET integrated database retrieval system