KEGG   Nitrospira defluvii: NIDE1105Help
Entry
NIDE1105          CDS       T01281                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nde  Nitrospira defluvii
Pathway
nde00010  Glycolysis / Gluconeogenesis
nde00051  Fructose and mannose metabolism
nde00562  Inositol phosphate metabolism
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01120  Microbial metabolism in diverse environments
nde01130  Biosynthesis of antibiotics
nde01200  Carbon metabolism
nde01230  Biosynthesis of amino acids
Module
nde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE1105 (tpiA)
   00051 Fructose and mannose metabolism
    NIDE1105 (tpiA)
   00562 Inositol phosphate metabolism
    NIDE1105 (tpiA)
Enzymes [BR:nde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NIDE1105 (tpiA)
Exosome [BR:nde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NIDE1105 (tpiA)
  Exosomal proteins of bladder cancer cells
   NIDE1105 (tpiA)
  Exosomal proteins of melanoma cells
   NIDE1105 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBK40864
UniProt: D8PCA5
Position
complement(1074996..1075775)
Genome map
AA seq 259 aa AA seqDB search
MRTRFIVGNWKMNKTASEGGAFVHRLSQELTHHAGIQIGLTPPFTALHAVREALGPASAF
LLGAQNLYWEDKGAFTGEVSGTMLKDIGCQFVLVGHSERRQYFGDQDGWTNKKVLAALRH
GLQPILCVGETLQDRESGQTDLVIQRQLRAGLSGIESQTLSTVTIAYEPVWAIGTGRAAS
PEQAVPVHRLIRKTLNELGGADIGNHVRILYGGSVTPHNIADFLASEEIDGALVGGACLD
PVSFATLAKVAIGSKPTTA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacgcgtttcatcgtcggcaactggaaaatgaataagaccgcttccgaaggcggg
gcgttcgttcatcgcctatcacaggaattgacccaccatgccggcatccaaatcggcctg
acaccgccctttacggcgctgcacgccgtacgcgaagcgctgggcccggcctcagccttc
ctcctcggcgcacaaaatctctattgggaagataaaggagcattcaccggcgaagtgtcc
gggaccatgctgaaagacatcggttgccagtttgtcctcgtcggccattcggagcgacga
cagtatttcggagaccaggacggctggacgaataaaaaagttctggccgccctccggcat
ggccttcaaccgattctgtgcgtgggagaaacactccaggatcgtgagtccggacagacc
gacctcgtcattcaacgacagcttcgtgccggactttccgggatcgagtcacagacgctt
tcaaccgtgacgatcgcctatgagccagtgtgggccattggaacaggacgggctgcgtcg
ccggagcaagcggtcccagttcaccgactcatccgcaagaccctaaacgaactgggcgga
gcggacataggaaaccacgtccgcattctgtacggaggaagcgtcacaccgcacaatatc
gccgacttcttggcatctgaagaaatcgacggcgcacttgtcggcggggcttgtttagac
ccggtctcttttgctacactcgccaaagtcgcaatcgggtccaaacccaccacggcctaa

DBGET integrated database retrieval system