KEGG   Candidatus Nitrospira defluvii: NIDE1217Help
Entry
NIDE1217          CDS       T01281                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NIDE1217 (hemY)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NIDE1217 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185840..1187294
Genome map
AA seq 484 aa AA seqDB search
MARTPRSVVIVGGGISGLSTAFALQEQAAAAGMALTCTILDAAPVWGGKILTHRVGQLVM
EAGPDSFLSQKPWGMELCRRLGIADQLINTNPVEKKASVLRGGQLHELPEGLVTFTPTQL
GPFFRSGLLSWVDLARMGCDVLIPPRRSTDDESLASFFRRRFGRHACERVMEPLMAGIYA
GDAEQMSLRATFPRFYELEQAHGSVIRGMMAARRARAQKVSGGGPRHTMFVTLKNGLADL
VAGLTAQIQQAGGVLKAGVQAEALRVRSHQAGRWMYDVMCTDGTAISAEALVLATPAYVS
AELVRPLTPMAAGLMDMIPYASTATISLIYPAEAVGNRLQGFGFVVPRSEGRDLIAATWT
SLKWPHRAPPEDVSVRCYLGGVGREVILQRDDEALVRCVREELASIVGLQATPHYVEVNR
WNRAMPQYTLGHLDRLVQLDAALSRFGGLAVTGAGYRGVGLPDCIRDGADTAAKILHYLH
TAPM
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcactccacggtcagttgtcatcgtcggcggaggcatctcaggcctctctacg
gcgtttgctctccaggagcaggcggccgcggctggtatggccctcacctgtaccatcctt
gacgcggcaccggtctggggtggaaaaattctcacccatcgggtcgggcagttggtcatg
gaagcggggcccgactcgttcctctcgcaaaagccctggggcatggagctctgccggcgt
ctcgggatagccgatcagctcatcaacaccaacccggttgagaaaaaggcaagtgtcttg
aggggcgggcagttgcacgagttgccggaagggctcgtgacattcacgccgactcagctg
gggccgttttttcgcagtggtttgttatcctgggtcgatcttgcccgtatgggctgcgat
gtgctgattccgccgcgtcgttccaccgacgacgaatcgctggcgtcgtttttccgtcgc
cggtttggtcgtcatgcatgcgagcgggtgatggagccgctgatggccggcatttatgcc
ggcgatgcggagcagatgagccttcgggcgacattcccccgcttctacgagctggagcag
gcgcacggcagtgtgattcgcggcatgatggcggcccgccgtgcacgggcgcagaaggtg
tccggaggaggcccccggcacacgatgtttgtgacgctgaagaacggcctggctgatctg
gtggccgggctgacggcgcagatccagcaggccggcggggtgctgaaagccggtgttcag
gcggaggcgttacgggtgcgctcgcatcaggccgggcgctggatgtacgatgtgatgtgc
accgacgggacggcgatttcggcggaagcgctggtcttggcgacgccggcgtatgtcagc
gctgaactcgttcggccgttgacgccgatggcggccggcttgatggacatgattccctat
gcctcgacagccacaatctctctcatctatcctgccgaagcagtggggaaccggctccaa
ggcttcggcttcgtggttccacgaagcgagggccgtgatctgattgccgcgacttggacc
tccctcaaatggcctcatcgtgcaccaccggaggatgtgtcggtgcgttgttacctcggc
ggggtcgggcgagaagtcattttgcagcgcgacgatgaggccctggtccggtgcgtacgc
gaggaattggcctccatcgtgggcctgcaggcgacaccgcattatgtcgaggtgaatcgc
tggaatcgggccatgcctcaatatactcttgggcacctcgatcggcttgtgcaactggat
gcggcactctcgcgattcggcggcttggccgtcaccggcgcaggctatcggggtgtgggc
cttcccgattgtattcgggacggcgctgatacggcggcaaagatactgcattatctacac
accgcgccgatgtga

DBGET integrated database retrieval system