KEGG   Nitrospira defluvii: NIDE1217Help
Entry
NIDE1217          CDS       T01281                                 

Gene name
hemY
Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
nde  Nitrospira defluvii
Pathway
nde00860  Porphyrin and chlorophyll metabolism
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NIDE1217 (hemY)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NIDE1217 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     NIDE1217 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase DAO NAD_binding_8 NAD_binding_9 Pyr_redox_2 HI0933_like Thi4
Motif
Other DBs
NCBI-ProteinID: CBK40973
UniProt: D8PCL4
Position
1185840..1187294
Genome map
AA seq 484 aa AA seqDB search
MARTPRSVVIVGGGISGLSTAFALQEQAAAAGMALTCTILDAAPVWGGKILTHRVGQLVM
EAGPDSFLSQKPWGMELCRRLGIADQLINTNPVEKKASVLRGGQLHELPEGLVTFTPTQL
GPFFRSGLLSWVDLARMGCDVLIPPRRSTDDESLASFFRRRFGRHACERVMEPLMAGIYA
GDAEQMSLRATFPRFYELEQAHGSVIRGMMAARRARAQKVSGGGPRHTMFVTLKNGLADL
VAGLTAQIQQAGGVLKAGVQAEALRVRSHQAGRWMYDVMCTDGTAISAEALVLATPAYVS
AELVRPLTPMAAGLMDMIPYASTATISLIYPAEAVGNRLQGFGFVVPRSEGRDLIAATWT
SLKWPHRAPPEDVSVRCYLGGVGREVILQRDDEALVRCVREELASIVGLQATPHYVEVNR
WNRAMPQYTLGHLDRLVQLDAALSRFGGLAVTGAGYRGVGLPDCIRDGADTAAKILHYLH
TAPM
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcactccacggtcagttgtcatcgtcggcggaggcatctcaggcctctctacg
gcgtttgctctccaggagcaggcggccgcggctggtatggccctcacctgtaccatcctt
gacgcggcaccggtctggggtggaaaaattctcacccatcgggtcgggcagttggtcatg
gaagcggggcccgactcgttcctctcgcaaaagccctggggcatggagctctgccggcgt
ctcgggatagccgatcagctcatcaacaccaacccggttgagaaaaaggcaagtgtcttg
aggggcgggcagttgcacgagttgccggaagggctcgtgacattcacgccgactcagctg
gggccgttttttcgcagtggtttgttatcctgggtcgatcttgcccgtatgggctgcgat
gtgctgattccgccgcgtcgttccaccgacgacgaatcgctggcgtcgtttttccgtcgc
cggtttggtcgtcatgcatgcgagcgggtgatggagccgctgatggccggcatttatgcc
ggcgatgcggagcagatgagccttcgggcgacattcccccgcttctacgagctggagcag
gcgcacggcagtgtgattcgcggcatgatggcggcccgccgtgcacgggcgcagaaggtg
tccggaggaggcccccggcacacgatgtttgtgacgctgaagaacggcctggctgatctg
gtggccgggctgacggcgcagatccagcaggccggcggggtgctgaaagccggtgttcag
gcggaggcgttacgggtgcgctcgcatcaggccgggcgctggatgtacgatgtgatgtgc
accgacgggacggcgatttcggcggaagcgctggtcttggcgacgccggcgtatgtcagc
gctgaactcgttcggccgttgacgccgatggcggccggcttgatggacatgattccctat
gcctcgacagccacaatctctctcatctatcctgccgaagcagtggggaaccggctccaa
ggcttcggcttcgtggttccacgaagcgagggccgtgatctgattgccgcgacttggacc
tccctcaaatggcctcatcgtgcaccaccggaggatgtgtcggtgcgttgttacctcggc
ggggtcgggcgagaagtcattttgcagcgcgacgatgaggccctggtccggtgcgtacgc
gaggaattggcctccatcgtgggcctgcaggcgacaccgcattatgtcgaggtgaatcgc
tggaatcgggccatgcctcaatatactcttgggcacctcgatcggcttgtgcaactggat
gcggcactctcgcgattcggcggcttggccgtcaccggcgcaggctatcggggtgtgggc
cttcccgattgtattcgggacggcgctgatacggcggcaaagatactgcattatctacac
accgcgccgatgtga

DBGET integrated database retrieval system