KEGG   Candidatus Nitrospira defluvii: NIDE1465Help
Entry
NIDE1465          CDS       T01281                                 

Gene name
forB2
Definition
2-oxoacid:ferredoxin oxidoreductase subunit beta (EC:1.2.7.3)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nde01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nde00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nde00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nde00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nde00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nde00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:nde00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398917..1399810
Genome map
AA seq 297 aa AA seqDB search
MSLDYVKFTTGFEQFMPKEYRDMVEHGPFGKKTTVSQMGSFKEILEEHPMCAGCAMTLFI
RLAIIAFPNPEDTITVGTAGCGRLAISQAAIPFVYGNYGDQNGVASGLSRGLRLRFGDKP
KDVVVIAGDGGTADIGFQQVLHSWFRKERFTTIMLDNEVYGNTGAQESGMTTRGAVLKMA
PLGKKFEKMDMVTMAKVAGCSYIATVVPNNPRRVESVIKKAVLIARDVGPTYIQAYTSCN
IEYAIPTDKVMEDAKTVEDDRYKFTEYVSDEAKAYLAERYGYKEFMPKAVPASVTTA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgattatgtgaagttcacaaccggctttgaacagttcatgccgaaagaatat
cgggatatggtcgagcatggaccattcggaaaaaagacgacggtgtcgcagatgggcagc
ttcaaggaaatcctggaggagcacccaatgtgtgccggttgcgcgatgaccttgttcatt
cggttggcgatcattgcttttccgaatcccgaagacaccattaccgtcgggacggcgggt
tgtggcagattggccatttcgcaagcggcgattccgttcgtgtacgggaattacggcgac
cagaacggtgtcgccagcggtttatcgcggggactccggctccgtttcggcgacaagccg
aaggatgtggtcgtaatcgcgggtgatggaggaaccgccgacatcgggtttcagcaggtg
ttgcattcctggtttcggaaggaacggttcacgaccatcatgctggacaacgaagtgtac
ggcaacaccggcgctcaggaaagcgggatgacgaccagaggcgccgtgctgaaaatggct
ccgctcggaaagaagttcgagaagatggacatggttacgatggccaaagtcgccggctgt
tcctatatcgccacggttgtgccgaacaatccgcggcgggtggaaagcgtcatcaagaag
gccgtgctgatcgcccgggacgtcggaccgacctatattcaggcgtacacatcgtgcaac
atcgagtatgcgatcccgaccgacaaggtcatggaagatgccaagaccgttgaagacgat
cgttacaaatttaccgagtatgtcagcgacgaagcgaaggcgtaccttgccgagcgttat
ggctacaaggaattcatgccgaaggccgtgcctgcttccgtcacgacggcctga

DBGET integrated database retrieval system