KEGG   Candidatus Nitrospira defluvii: NIDE1590Help
Entry
NIDE1590          CDS       T01281                                 

Definition
putative protein phosphatase (EC:3.1.3.16)
Orthology
K01090  
protein phosphatase [EC:3.1.3.16]
Organism
nde  Candidatus Nitrospira defluvii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514413..1515219)
Genome map
AA seq 268 aa AA seqDB search
MSTQKTRWAWTAFGQTDRGLVRPTNQDTYLVENRHRLWAVADGMGGHPGGDVASRLVMDS
LAELAPTLEGTATAPGRDAEEHATSRLTTMAEQAHASVLAHAAQHPSLHGMGTTLVMAHL
LPLPKPRLLVLNVGDSRAYLVRAGTLTQLTRDHTLIDEYVRDGRLTPAQAARRPNRHVLT
RAMGLAPHLERDLFVFDLLDGDLLLLCSDGLTKMLTDERVLQTVRPHQHLPSLATQALIQ
TALDAGGIDNVTVVACTITEIPDQTNIH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacacaaaagaccagatgggcatggaccgcgttcgggcagacggaccgcgggttg
gtccgtcccacaaatcaggacacctacctcgtcgaaaatcgacatcgcctctgggcggtg
gccgacggaatgggaggccacccggggggagatgtggccagccgtctcgtgatggactcc
ctcgccgaactggcgccgactctcgagggaactgcaactgcccccggccgtgacgcagaa
gagcacgcaacctcccgtcttacaaccatggcggagcaggcccatgcctccgttctcgcc
catgccgctcagcacccgtcgctacacggcatgggcacgacactcgtgatggcccatctc
ctgccgctacccaagccacgcttacttgttttgaacgtcggcgatagccgggcctatctg
gtcagagccggcaccctcacgcaactgactcgggaccataccctgattgatgagtacgtc
cgtgacggacgcctcacgcctgcgcaggccgcgcgccgcccgaaccgccatgtgctcacc
cgcgccatgggccttgcccctcacttggaacgcgacctgttcgtcttcgatcttctcgat
ggagacctcctgctgctctgctcagacggcctcacaaaaatgttgaccgacgaacgcgtg
ctgcagaccgtgaggcctcatcagcatctcccttctcttgccacccaggcactgattcaa
acagcgctcgatgcggggggaatcgacaacgtcacggtggtggcgtgcaccattactgag
atacccgatcagacaaatatccattga

DBGET integrated database retrieval system