KEGG   Candidatus Nitrospira defluvii: NIDE2031Help
Entry
NIDE2031          CDS       T01281                                 

Gene name
fbpV
Definition
fructose-1,6-bisphosphatase, class V (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:nde01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nde01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nde00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nde00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nde00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:nde00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948947..1950059
Genome map
AA seq 370 aa AA seqDB search
MAAENAQKITLSVIKADIGGFVGHSAMHPALMDCANEKLAAAKSGGLLVDYHVSACGDDL
QLIMTHRHGVDHEPIHRLAWDTFEAGTAVAKELHLYGAGQDLLADAFSGNVRGQGPGVAE
MEFVERKSDPVLIFMADKTSAGAWNLPLYKMFADPFNTAGLVIAPTLHQGFRFEVHDIYE
HKKISFDCPEELYDMLMFIGSPGKYTIKYVYSRADGTIAAASSTERLSLIAGKYVGKDDP
VMIVRAQQNFPAVGEVLDPFRYPWIIEGWMRGSHYGPLMPVSVKQATPTRFDGPPRVACL
GFQLADGKLVGPRDMFDDPSYDEARRDANRIADVLRMHGPFEPHRLPLDDMEYTTMPQIM
KKLEGRWAKV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagagaatgcacagaaaatcacgttaagtgtgatcaaggcggacatcggcgga
ttcgtcgggcattcagccatgcatccggccttgatggattgcgcgaatgagaagcttgcg
gcggcgaagagcggcgggttgctcgtcgattaccacgtgtcggcctgtggggatgacttg
cagctgatcatgacgcatcgccatggtgtcgatcatgaaccgatccaccgtctggcgtgg
gacacgtttgaggccggcacggcggtcgccaaggagttgcatctctacggcgcggggcaa
gacctactggccgatgcgttcagcggaaacgtacgcggacaaggacccggcgtggctgag
atggagttcgtggaacggaagtccgatccggtgctgatcttcatggcggacaaaacttcg
gcaggcgcctggaatctccctctgtataagatgttcgccgatccgttcaatacggcgggt
ctcgtcattgcgcccacgttgcaccaggggtttcgctttgaggtgcacgatatctacgag
cacaagaagatctcattcgattgtcccgaagaactctacgacatgttgatgttcatcggt
tcacccggtaaatacacgatcaagtacgtatactcgcgggcggatgggacgattgcggcg
gcctcgtcgacggagcggctttcgctcattgcgggtaagtatgtcggaaaagatgatccg
gtgatgatcgtccgcgcgcagcagaactttccggcggtgggcgaggtgctcgatccgttc
cggtatccctggatcatcgagggctggatgcgtggttcgcactatggcccgctgatgccg
gtctcggtgaagcaggcgacgccgacccgcttcgacgggcctccgcgtgtcgcctgtctg
ggatttcaattggccgacggcaaactcgtcgggccgcgggatatgttcgacgatccgtcg
tatgatgaagcgcgccgggatgcgaaccggatcgccgatgtcttgcggatgcacggtccc
tttgaaccgcaccggttgcccctcgacgacatggagtacacgaccatgccgcagattatg
aagaagttggaaggtcgctgggctaaggtgtag

DBGET integrated database retrieval system