KEGG   Candidatus Nitrospira defluvii: NIDE2031Help
Entry
NIDE2031          CDS       T01281                                 

Gene name
fbpV
Definition
fructose-1,6-bisphosphatase, class V (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE2031 (fbpV)
   01230 Biosynthesis of amino acids
    NIDE2031 (fbpV)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE2031 (fbpV)
   00030 Pentose phosphate pathway
    NIDE2031 (fbpV)
   00051 Fructose and mannose metabolism
    NIDE2031 (fbpV)
  Energy metabolism
   00680 Methane metabolism
    NIDE2031 (fbpV)
Enzymes [BR:nde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NIDE2031 (fbpV)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NIDE2031 (fbpV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1948947..1950059
Genome map
AA seq 370 aa AA seqDB search
MAAENAQKITLSVIKADIGGFVGHSAMHPALMDCANEKLAAAKSGGLLVDYHVSACGDDL
QLIMTHRHGVDHEPIHRLAWDTFEAGTAVAKELHLYGAGQDLLADAFSGNVRGQGPGVAE
MEFVERKSDPVLIFMADKTSAGAWNLPLYKMFADPFNTAGLVIAPTLHQGFRFEVHDIYE
HKKISFDCPEELYDMLMFIGSPGKYTIKYVYSRADGTIAAASSTERLSLIAGKYVGKDDP
VMIVRAQQNFPAVGEVLDPFRYPWIIEGWMRGSHYGPLMPVSVKQATPTRFDGPPRVACL
GFQLADGKLVGPRDMFDDPSYDEARRDANRIADVLRMHGPFEPHRLPLDDMEYTTMPQIM
KKLEGRWAKV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagagaatgcacagaaaatcacgttaagtgtgatcaaggcggacatcggcgga
ttcgtcgggcattcagccatgcatccggccttgatggattgcgcgaatgagaagcttgcg
gcggcgaagagcggcgggttgctcgtcgattaccacgtgtcggcctgtggggatgacttg
cagctgatcatgacgcatcgccatggtgtcgatcatgaaccgatccaccgtctggcgtgg
gacacgtttgaggccggcacggcggtcgccaaggagttgcatctctacggcgcggggcaa
gacctactggccgatgcgttcagcggaaacgtacgcggacaaggacccggcgtggctgag
atggagttcgtggaacggaagtccgatccggtgctgatcttcatggcggacaaaacttcg
gcaggcgcctggaatctccctctgtataagatgttcgccgatccgttcaatacggcgggt
ctcgtcattgcgcccacgttgcaccaggggtttcgctttgaggtgcacgatatctacgag
cacaagaagatctcattcgattgtcccgaagaactctacgacatgttgatgttcatcggt
tcacccggtaaatacacgatcaagtacgtatactcgcgggcggatgggacgattgcggcg
gcctcgtcgacggagcggctttcgctcattgcgggtaagtatgtcggaaaagatgatccg
gtgatgatcgtccgcgcgcagcagaactttccggcggtgggcgaggtgctcgatccgttc
cggtatccctggatcatcgagggctggatgcgtggttcgcactatggcccgctgatgccg
gtctcggtgaagcaggcgacgccgacccgcttcgacgggcctccgcgtgtcgcctgtctg
ggatttcaattggccgacggcaaactcgtcgggccgcgggatatgttcgacgatccgtcg
tatgatgaagcgcgccgggatgcgaaccggatcgccgatgtcttgcggatgcacggtccc
tttgaaccgcaccggttgcccctcgacgacatggagtacacgaccatgccgcagattatg
aagaagttggaaggtcgctgggctaaggtgtag

DBGET integrated database retrieval system