KEGG   Nitrospira defluvii: NIDE2043Help
Entry
NIDE2043          CDS       T01281                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nde  Nitrospira defluvii
Pathway
nde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01130  Biosynthesis of antibiotics
nde01230  Biosynthesis of amino acids
Module
nde_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIDE2043 (trpC)
Enzymes [BR:nde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NIDE2043 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: CBK41763
UniProt: D8PEV4
Position
1962367..1963191
Genome map
AA seq 274 aa AA seqDB search
MILDRILEHKKAEIRHKNSRGYLAELKTRIRDAGPTLGFAVNLDARRTPDRPALIAEVKK
ASPSLGLLRPEFEQRFEPVAIAEAYREHGAAAVSVLTDKDFFQGSLEYLSDVKQNVGLPA
LNKEFMVADIQFYEARAHGADAVLLIVAGLEKRQLIDFSALAKELSLDVLVETHHERELD
IVLEWLPDVRLIGINNRDLNTFSTDLGVTLRLAKRIPGDKLIVSESGIHKREDVTRLVEA
GVHAMLIGESLIRAQDIGVKIRELLGDESNKEKP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgattctcgatcggattctcgaacataaaaaagcggaaattcgccacaagaacagccgc
ggctatctcgcggagctgaaaaccagaattcgcgatgccggtccgacgctggggtttgcc
gtgaatctcgacgcgcgcaggactccagacaggcccgcgctcattgcggaggtcaagaag
gcctcgccgagtctcggtctgttgcggccggagttcgagcagcgctttgagccggtggcc
atcgccgaagcctatcgcgagcatggggccgcggctgtctccgtgttgacggacaaggat
ttttttcagggcagcctggagtatctctccgatgtgaaacagaacgtcggcctgcctgcg
ctgaacaaagagttcatggtggcggacattcagttctatgaagccagggcccatggcgcg
gacgcggtcctgttgatcgtggccgggttggagaagcgccaattgatcgacttctccgcc
ttggcgaaagagttgtcgctcgatgtgctggtcgagacgcatcatgagcgtgaactcgat
atcgtgttggaatggctcccggatgtgcggctgatcggcatcaacaatcgtgacctcaac
accttctcgacggatctgggtgtgaccctgcggttggccaagcgtattcccggcgacaag
ttgatcgtgagtgaaagcgggattcacaagcgggaggatgtcacgcggttggtggaggcc
ggcgtccatgccatgctgatcggcgagtcgctgatccgggcgcaggacatcggcgtgaag
attcgtgaactgctgggcgatgaatccaacaaggagaagccatga

DBGET integrated database retrieval system