KEGG   Nitrospira defluvii: NIDE2046Help
Entry
NIDE2046          CDS       T01281                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nde  Nitrospira defluvii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NIDE2046 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIDE2046 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIDE2046 (trpB)
Enzymes [BR:nde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NIDE2046 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1964187..1965377
Genome map
AA seq 396 aa AA seqDB search
MAIPDRHGRFGPYGGRYVPETLMPALLELEEVYERTRRDKGFQAELKHYLKEYVGRPTPL
YFAQRLTKRLGGAKIYLKREDLCHTGAHKINNAIGQALLARRMKKPRLIAETGAGQHGVA
TATVAAMFGLECEIYMGTEDMQRQALNVFRMRLLGSTVTGVDAGSRTLKDAISEAMRDWT
TNVRTTHYVLGSVLGAHPYPMMIRDFQSVIGREARKQILATEGRLPDCLIACVGGGSNAM
GLFHAFVPDKKVRMVGVEAGGLGVESGKHAARFAGGRPGVLQGTMTYLLQDENGQVNLTH
SVSAGLDYAAVGPEHSYYKETNRAQYTSVTDDEALEAFDLLAREEGIMPALESAHAIAEV
VKCAPKMKKSQILIVNLSGRGDKDVQQVARIKGVTL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgataccagatcgacatgggcggttcggcccttatggcggacggtatgtccctgaa
actctcatgccggccttgctggaattggaagaggtatacgagcgcacacgccgggataag
gggtttcaagccgagctgaagcactatttgaaagaatatgtcgggcggccgacgccgctg
tatttcgcccagcgtctgacgaaacgattgggtggtgcgaagatttacctcaagcgcgag
gacctgtgccataccggcgcccataagatcaacaatgcgatcgggcaggcgttgctcgcc
cggcgcatgaagaaaccgcgcctcattgctgagaccggcgcggggcagcacggagtggcg
acggccactgtcgccgctatgttcggcctggaatgtgaaatctacatgggcacggaagat
atgcagcgacaggcgctgaacgtgttccggatgcggctcctgggttcgacggtcaccggc
gtagatgccggcagccggacgttgaaggatgccatcagtgaagcgatgcgggattggacg
accaatgtgcggacgacccactatgtgctgggttccgtcctcggcgcgcatccctatccg
atgatgatccgggattttcagtccgtcatcggccgtgaagcccgcaaacagattctggca
accgaagggcgtctgcccgattgtctgatcgcctgtgtcggcggcggcagcaatgcgatg
gggctgttccatgccttcgttccggacaagaaggtcaggatggtgggggtcgaagccggg
gggctgggtgttgagagcggcaaacatgcggcccggtttgcgggcggtcgtcccggcgta
ttgcaggggaccatgacctatctcctgcaggacgagaacggccaggtgaatctcacgcat
tccgtctcggcaggcttggactatgcggccgtgggaccggagcacagctactacaaggaa
acgaatcgtgcccagtatacgtcggtcacggacgacgaggcgttggaggcgttcgatctg
ctcgcgcgggaggaagggatcatgcccgcgctggaaagcgcccatgccatcgccgaagtg
gtgaagtgcgcgccaaaaatgaagaagagccagatcctgatcgtgaacctgtccgggcgc
ggcgacaaggatgtgcagcaggtggccagaatcaagggcgtgacgctgtag

DBGET integrated database retrieval system