KEGG   Nitrospira defluvii: NIDE2047Help
Entry
NIDE2047          CDS       T01281                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nde  Nitrospira defluvii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NIDE2047 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIDE2047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NIDE2047 (trpA)
Enzymes [BR:nde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NIDE2047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1965547..1966347
Genome map
AA seq 266 aa AA seqDB search
MNRLDQTFGRLNARGEKALITYIMAGDPSLQETEQLVLELERAGADVIELGVPFSDPIAD
GPVIQKAAERGLQSGTSLRRILESVRHLRVSTQIPIVLMAYYNNIHAFGEAEFCRIAADA
GVDGLIVPDMPPDEAGPLRGPAGEAGLHLIFLLAPTSTASRRAYVAKESGGFVYYVSITG
ITGAKLQDVAGVRENVAKIRKHTKTPVAVGFGVATPEDAARVAQVADGVIVGSAIVRRVG
EHGQDGRLVQEVGAFVRSLKEAMQPA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtttggatcaaacattcggccgattgaacgcacggggagagaaagctctgatc
acctacatcatggcgggagacccgtcgttgcaggagacggagcagctggtgctcgaattg
gagcgggcgggcgccgacgtcatcgaattaggggtgccattctccgatcccatcgccgat
ggaccggtgattcagaaagcagccgaacgtggtctccaaagcggtacatcccttcggagg
attctcgaatcggtgcggcatcttcgggtctcgacccagatccctatcgtcttgatggcc
tattacaacaacattcacgcgttcggtgaggcggaattctgccggatcgctgcggatgcg
ggtgtggatgggttgatcgttccggatatgccgccggatgaggcggggccgttgcgtggt
ccggctggtgaggccgggctccatctgatttttctgttggctccgaccagcactgcgtcg
cggcgggcctatgtggcgaaggagtccggcggatttgtctattatgtttccatcacgggc
attactggggctaaactacaggacgtggcgggcgtacgcgagaacgtcgccaagatcaga
aagcacaccaagaccccggtggcggtgggattcggcgtggcgactccggaggatgccgcg
cgggtggcgcaggtcgccgatggcgtgatcgtgggcagcgcaattgtgcgtcgtgttgga
gagcatgggcaggatggccgactcgttcaggaagtgggtgcgttcgtgcgatccctcaag
gaggcgatgcagccggcctag

DBGET integrated database retrieval system