KEGG   Candidatus Nitrospira defluvii: NIDE2367Help
Entry
NIDE2367          CDS       T01281                                 

Gene name
cheB
Definition
chemotaxis methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:nde02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:nde02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2316240..2317289
Genome map
AA seq 349 aa AA seqDB search
MAKIRVLTIDDSALMRQVLAELLSKDPAIEVIGSAPDPYVAREKIKALNPDVLTLDVEMP
KMDGLTFLEKLMRGRPMPVIMVSSLTESGCQTTLRALELGAVDFITKPKIDLREGMDNLA
DDLIAKVKGAATACIRRGAPVSSPDGARPSVLSSAMIKTTDMIIAIGSSTGGTEAVKEVL
QVLPPNTPPVLITQHMPERFTKTWADRMNQLCRISVKEAEDGDSVLPGHALIAPGNYHMT
LVRSGARYSVRINQHEPVNRHRPSVDVMFDSVAQYAGGNAVGVILTGMGGDGAKGLLRMK
EAGAYTIAQDEASCVVFGMPKEAIKLGAAEIVRPLNDIATTILNHVTRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatccgggttctgacgatcgacgattctgcgctgatgcggcaggtgctggcc
gaactgctttccaaggatcctgccatcgaagtgatcggcagcgcgccggatccctatgtg
gccagagaaaaaatcaaggcgctcaaccccgacgtgctcacgctggacgtggaaatgccg
aagatggacgggctcacgtttctcgaaaagctcatgcgcgggcgtcccatgcctgtgatt
atggtgagttcgctgacggaatccggttgccagaccacactgcgggcattggaactggga
gccgtcgatttcattaccaaacccaagatcgatctccgtgaggggatggacaatctcgcc
gacgatctgatcgcaaaagtcaaaggcgctgccacggcctgcattcggcgaggagccccg
gtgtccagcccggacggcgcccggccgtcggtcttgagttcggccatgattaagaccacg
gatatgatcatcgccatcggctcttcgaccggaggcactgaggcggtcaaggaggtgcta
caagtcctaccgcccaacactcctccggttctgatcactcagcacatgccggagcggttc
accaaaacctgggccgaccggatgaaccaactctgccgcatctccgtgaaggaggccgag
gacggagacagcgtcctgccggggcacgcgctgattgctcccggcaattaccacatgacc
ctggtccgcagcggcgcgcgctattcggtccgcatcaaccaacacgaaccggtcaatcgc
catcgcccgtcggtcgacgtcatgttcgactccgtcgcgcaatatgccggcggcaacgcg
gtgggtgtgatcctgaccggaatgggcggagacggcgccaagggactgctgcggatgaag
gaagccggcgcctataccatcgcgcaagatgaggcctcgtgcgtggtgttcggaatgccg
aaagaggccattaagctcggggccgccgagatcgtccggccgctcaacgatattgcgacg
actattttgaaccatgttacccgtgcctga

DBGET integrated database retrieval system