KEGG   Nitrospira defluvii: NIDE2462Help
Entry
NIDE2462          CDS       T01281                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nde  Nitrospira defluvii
Pathway
nde00230  Purine metabolism
nde01100  Metabolic pathways
Module
nde_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NIDE2462 (gmk)
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NIDE2462 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_23 AAA_18 AAA_22 RNA_helicase NTPase_1 AAA
Motif
Other DBs
NCBI-ProteinID: CBK42172
UniProt: D8PFY5
Position
2409751..2410410
Genome map
AA seq 219 aa AA seqDB search
MFIISAPSGSGKTTLCKQITANVPGLWHSISYTTRKPRPGEVDGQDYYFLDEPAFRQMID
RNEFVEWAHVYGNLYGTPRKMLTEKMEQGIDVLLEIDVQGARSVKKKFEDGVYIFILPPS
FDTLRTRLQNRAGDSPDEIQRRLQKAKEEVWSYREYYYIVRNDDLKQSLKELESIFLAER
IKTKRLNMTWLEEKFILDKEGKQGNSSSAPASKEHLHHG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgtttatcatttcggctccgtcgggaagcgggaagacgacgttgtgcaaacagatcacg
gccaatgttcccggattgtggcactcgatctcctacaccacgcgcaaaccgcggccaggc
gaggtggatgggcaggattactattttctcgatgagccggccttccgtcagatgatcgat
cgaaatgaattcgtcgaatgggcgcatgtctacggcaatttgtacggcacaccgcgcaag
atgctgaccgagaaaatggaacagggtatcgacgtgctgctcgaaatcgacgtgcagggc
gcgcgctcagtgaaaaagaagtttgaagacggcgtctatatcttcattctgccgccgtcg
ttcgacacgctgcggacaaggcttcaaaaccgggctggagactcgccggacgaaattcaa
cgccgcctccagaaggccaaagaagaggtctggagctaccgggagtactactatatcgtc
cggaacgacgacctgaagcaatccttgaaagagctcgaaagcattttcctggcggaacgg
atcaaaaccaaacgcctgaacatgacgtggttggaagaaaaattcattctcgacaaagag
ggtaagcaggggaattcttcctccgcccccgcatcaaaggagcacttgcatcatgggtga

DBGET integrated database retrieval system