KEGG   Candidatus Nitrospira defluvii: NIDE2539Help
Entry
NIDE2539          CDS       T01281                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nde00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nde00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478941..2479861
Genome map
AA seq 306 aa AA seqDB search
MGLKRKDLLSLTNLSADDITLILETADSFKEVSGREIKKVPALRGKTVVNLFFEPSTRTR
TSFELAAKRLSADVINFSPSSSSVVKGETLLDTARNIEAMQADIIVLRHSSAGAAETLAR
GVKSSVINAGDGWHEHPTQALLDLYTIRSRQMGFAGLRVAIVGDVAHSRVARSNIFALTK
LGAEVRVVGPPTMIPLQISQLGVQVYHNLDEALRGVNVIMMLRLQLERQGRALFPTIREY
ARHYGLTGERVKLAEPGAIVMHPGPINRGVEIAPDVADSLSSVILDQVANGVAVRMGILY
LMSGAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggggctcaaacggaaagacctgctcagcctgaccaacctgtcggcggacgatatcacg
ttgatcctggaaaccgcggattccttcaaggaagtctccggccgggagatcaagaaggtg
ccggccttacgaggcaagacggtcgtgaacctcttcttcgaaccgagcaccagaaccaga
acgtcgtttgaattggccgccaagcggctcagcgccgatgtgatcaatttttccccctct
tccagcagcgtggtgaagggggaaacgctcctggatacggcccggaacatcgaagccatg
caggccgacatcatcgtcctgcggcactcctcggccggcgcggcggagaccctggcgcgg
ggagtgaaatcctcggtgatcaatgccggggacggatggcatgaacatccgacacaggct
ctgctcgacctgtacacgatccgcagccggcaaatgggcttcgccggattgcgcgtcgcg
attgtcggcgatgtggcgcacagccgtgtcgcccgctcgaatattttcgccctcacaaaa
ctcggggcggaagtgcgggtcgtcggccccccgaccatgattcctctacagatcagccag
ctcggagtgcaggtgtaccacaacttggacgaagcgctgcgcggcgtgaacgtaatcatg
atgttgaggctccaactggagcgacaggggcgcgcgttgtttccgacgatccgggaatat
gcgcgacactatggattgaccggcgaacgcgtaaaactggccgagcccggggccatcgtc
atgcatcccggtcccatcaaccgcggggtggaaatcgcccccgacgtggcggacagtctc
tcgtcggtcattctcgatcaggtggcgaacggcgtggccgtgcgtatgggcattttgtac
ctcatgtcgggagccggctga

DBGET integrated database retrieval system