KEGG   Candidatus Nitrospira defluvii: NIDE2743Help
Entry
NIDE2743          CDS       T01281                                 

Gene name
hemD
Definition
porphyrin biosynthesis protein HemD (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2692477..2694042)
Genome map
AA seq 521 aa AA seqDB search
MTTRAGIVYLVGAGPGDPKLLTIRGKECLEQADVVLYDYLANEALLQHVSPGAERLYVGR
RGRGQYRDQAEINRLLIDHAQAGKRVVRLKGGDPFVFGRGGEEAEAVAAAGLEFEVVPGV
TAAVAAPAYAGIPVTHRTMASTVTFVTGHEDPTKDRSGVEWPRLATVHGTLVFLMGMTNL
PKIVQCLRAEGKEGTTPVALIRWGTRASQRTVVGSLDDIVEKAAAAHMEPPTVIVVGEVV
RLREQLNWFERRPLFGKRILVTRPKPQAAEFSDLIAAQGGEPVECPTIEIVPPEDWAPLD
RALARLSTYNWLIFTSVNGVAPFMTRLLETQRDVRALSGLTICCIGPRTAEALAAYGLRA
DVIPEQFQAEGMLEVLAARQMRGARVLIPRALVARELLPDQLRTRGADVDVVPVYRTIRP
AVETDRLMEQLRTGGIDVISFTSSSTVRNFVELFPTKDELLRSVGKTTVACIGPITAATA
REAGLTVQVMARENTVPALADAIVEFVVNPIDGRTASAVSH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgcgcaggaatagtgtatttggtcggggccggtcccggagatcccaagttg
ctgacgatacgcggcaaggaatgtctggagcaggccgatgtggtgctgtacgactatctc
gcgaatgaagcgctcttgcagcatgtgtcaccaggggctgaacgtctctatgtcggccgg
cgcgggcgcgggcagtatcgcgatcaggcggagatcaatcggttgctgatcgatcacgct
caagcggggaagcgggtggtccgcttgaaaggtggcgatcccttcgtctttggtcggggc
ggggaagaggcggaagccgttgcggccgccgggctggaatttgaagtcgtccccggtgtg
acggccgccgttgcggcgccggcgtatgcgggtattccggtgacccatcgcacgatggcc
tccacggtgacgttcgtcaccggacacgaagaccccacgaaagatcgaagtggggtcgaa
tggccgcgcctggcgaccgtacatggcacgctggtgtttctcatgggcatgaccaacctg
ccgaaaatcgttcaatgcctgcgagctgaaggtaaagagggtacgaccccggttgcgctg
attcggtgggggacgcgagcttcgcaacgaaccgtggtggggagcttggacgatattgtg
gagaaggcggcggccgctcatatggaaccgcccacggtcatcgtggtcggcgaggtggtg
cgtcttcgggagcaactcaattggttcgagcgccggcccttgttcggaaaacggattctg
gtgacgaggccgaagcctcaagcggcggagttttccgatttgatcgcggctcaaggcggg
gaaccggtagaatgtccgaccatcgagatcgtaccccccgaagactgggctccgctggat
cgggccctggctcgtctgtcgacctacaattggttgatcttcaccagtgtgaacggggtt
gctccattcatgaccagactgttggagacgcaacgtgacgttcgtgcattgtccggcctc
accatttgttgcatcgggccgcgcaccgctgaggctctggccgcctatggcttacgtgcc
gacgtgattccggagcagtttcaagccgagggaatgctggaggtgttggccgcccggcag
atgcgcggggcccgcgtgttgattccgcgtgcgttagtggcccgggagctgcttccggat
cagctacgtacccggggggcggacgtggatgtggtgccggtctatcgcacgatcaggcct
gcagtcgagacggatcgcctcatggaacaactccgtaccggcgggatcgacgtgatttct
ttcacgagttcctcgacggtgaggaacttcgtcgagttgtttccgacgaaggacgagttg
ttgcgctcggtcgggaagacgaccgtagcctgcatcggaccgattaccgcggcgaccgcc
cgcgaggcgggtctcaccgttcaggtgatggcccgagagaacaccgttccagcgttggcc
gacgctatcgtggagtttgttgtgaatcctattgatggccgaaccgcttccgcggtaagc
cattga

DBGET integrated database retrieval system