KEGG   Candidatus Nitrospira defluvii: NIDE2903Help
Entry
NIDE2903          CDS       T01281                                 

Definition
putative phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:nde00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2839070..2840704)
Genome map
AA seq 544 aa AA seqDB search
MNASQALTKTRQFRNLLLSEHLQFICEAHNGLSAKIVQEAGFPGIWASGLSISAQFGVRD
NNEASWTQVLEDLEFMSDATRIPILLDGDTGYGNFNNMQRLIRKLEQRNIAAVCIEDKLF
PKTNSFLKGDAQPLADMQEFCGKIKAGKDAQTDPDFCLIARVEAFICGWGLAEALRRAEA
YHQAGADGILIHSALSVPDEILAFKREWGNRCPVVIVPTKYYATPTDVFRQHGFSMVIWA
NHMLRAAVASMQKTARALKESEHLLSIEDKVAPVSEIFRLQNAAELLEAEERYLPRGAEG
TSAVVLAASRGQELGELTEDQPKTMVKVQGVPILSHIVDAYNAVGIKDILVVRGYKKEAV
DLPNLTYIDNLEFAETGELASLSQALQSRKGRFQPTIVSYGDVLFNKYIPQALCQEQDDC
VIFVDSNWRDQSSYARLGGFAECSVPNSRKAFNAKIYLKQLGKTVPEESIHGVWMGFLKL
SSSAASQVNDLLLNMLADPANRRAGIPQLLQELLKRDVPVRVLYTVGHWLDVNSLEDVVQ
AGNF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgagccaagcattgaccaagacacgtcaatttagaaacctgctcctctctgaa
cacctgcagttcatctgcgaagcccacaacggactcagcgcgaaaatcgtccaagaggcc
gggtttcccggtatttgggccagcgggctctccatttcggctcagttcggcgtacgtgat
aacaatgaggccagctggacccaggtacttgaagacctggaattcatgtccgatgccacc
cggattccgatcctcctcgacggtgacacggggtacggcaatttcaacaacatgcagcgg
ctcattcgcaaactcgaacagcgcaatatcgccgcggtgtgcatcgaagataagttgttc
cccaagaccaacagttttctcaagggcgatgcgcagccgctcgccgatatgcaggaattt
tgcggcaaaattaaagctgggaaagatgcgcagaccgaccctgatttttgcctgattgcc
agggttgaggcctttatttgcgggtgggggttggcggaggcgttgcggcgtgcggaggcc
tatcatcaggcgggcgcggacggcattctcattcatagtgcgctctcggtgccggatgag
atcctcgcgttcaagcgggaatggggcaatcgttgtccggtggtgattgtccccacgaaa
tactatgcaacgccgacggatgtgtttcggcagcatggtttttcgatggtgatctgggca
aatcatatgctgcgcgcagccgtggccagcatgcagaaaaccgcgcgagcgttgaaggag
agtgagcatctcctctccattgaggataaggtcgcgccggtctctgaaatatttcgactg
cagaatgccgcggagttattggaggcggaagaacgttacctgcctcgaggtgccgagggc
acctcagcggtggtattggccgcgtcccggggacaggaattgggggaactgaccgaggac
caacccaagaccatggtgaaagtgcagggcgttcccatcctgagccacatcgtcgatgcc
tacaatgccgttgggattaaagatattttagtcgtccgtggttataagaaagaggcggtg
gacctccccaacttgacgtatatcgacaatcttgaatttgctgaaaccggcgaattggcc
tccttgtcccaggcgttgcaatccagaaaggggcgtttccagccgacgattgtttcctat
ggagatgtcttgttcaataagtatattccgcaggcgctgtgccaggagcaggatgactgc
gtgatttttgtcgacagcaactggagggatcaaagcagctatgcccgcttgggcggtttt
gccgaatgttccgttccgaattcgcggaaagccttcaatgcaaaaatctatctcaagcaa
ttggggaagaccgttcccgaagagtcgatccatggagtctggatggggtttcttaaactc
tcctccagcgcggccagccaggtcaatgatctcctgttgaacatgcttgccgatccggcg
aatcgaagggccggcattccgcaattgctgcaggaactcctgaaacgggacgtcccggtc
cgtgtgttgtatacggtcggtcattggttggatgtcaacagcctggaggatgttgtccag
gctgggaatttctga

DBGET integrated database retrieval system