KEGG   Nitrospira defluvii: NIDE2995Help
Entry
NIDE2995          CDS       T01281                                 

Definition
(GenBank) putative Asparagine synthetase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nde  Nitrospira defluvii
Pathway
nde00250  Alanine, aspartate and glutamate metabolism
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NIDE2995
Enzymes [BR:nde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     NIDE2995
Peptidases [BR:nde01002]
 Cysteine Peptidases
  Family C44
   NIDE2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700
Motif
Other DBs
NCBI-ProteinID: CBK42691
UniProt: D8PHF4
Position
complement(2941546..2943483)
Genome map
AA seq 645 aa AA seqDB search
MAGPGAAEVVRAMTGALVHRGPDDGGHYDDPPAKLCLGMRRLSILDLAHGHQPMANPEQS
VWIVYNGEIFNSPDLRRGLEQRGHRFHTANSDTETLLRLYDEKQEGMLEELNGMFAFVLH
DKRRNILFGARDRVGIKPLYYARRPDAFAFASELKSLLRMPGLTRTLDESSLSHYLTLRF
VPGTASIIRGVSRLAPGHWFRYGLETGRFETRCYWRPSFAPQEERSVEEWSELVRAELGA
AVRRWSLSDVPIGCSLSGGLDSSSIVGLLAESGHRQLKTYSLGFVGEGAAELDELPLARA
VAQRWGTDHHELVLQPEDLLRDLLKMVWALDEPYGGGLPSWYVFQFMQQDVKVGMTGTGG
DELFGDYGRYIQLEQRTSPGTQAAPLPAWLERGWPLVASLVDQIPHGIGGLRRKERWRHY
PEARRDPFGWDYVQAFYYLSESMKRTAVLTSPSDGRIIQDTVELLRDHYRESQSEQPRDA
VMHLAMQTQLPEEFLCMTDRFSMAHSLEARVPFLDHLFVEAVMRIPAQIRTKPEDPKYLL
RQAVRDLLPDDLLHAPKRGFVIPTARWLRGPLRPLAERLLAPARLAEQGIFRPEFYARFV
QPHVEGRADYHPQVWTALMFQLWHNLYIEQALTECPHFSWQELCR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcccggagccgctgaggttgtccgcgccatgaccggtgcgctggtccatcgt
ggcccggacgacggcggtcactacgacgatcctccggccaagctctgcctgggcatgcgc
cggctcagtattttggatctcgcgcacggccaccagccgatggcgaatcccgagcagtcg
gtgtggatcgtctacaacggcgaaatcttcaattctccggatctgcgccgcggacttgag
caacgcgggcaccggtttcatacggcgaattccgataccgaaacgctgttgcgattgtat
gacgagaagcaggagggcatgctggaggagttgaacggcatgttcgcctttgtgctccac
gacaagcggcgcaacattttattcggcgcacgggaccgggtgggaatcaagccgttgtat
tatgcccggcggcccgatgcgtttgcattcgcatcggagctgaagagcctgctgcggatg
cctggtcttactcgaactctcgatgaaagcagcctttcccactacctgacgctacggttc
gttccggggacggcttccatcatccgtggcgtgtcccggcttgcaccgggtcattggttt
cggtacggcttggagaccggccgattcgaaacccgctgttattggcgtccttcttttgcg
ccgcaagaggagcggtcggtggaggaatggagtgagctggttcgagccgagttgggcgcc
gcggttcgtcgttggagtctcagcgatgtgccgatcggctgctcgttgtccggcggattg
gactcatccagcatcgtcggactgttggccgagagcggtcatcggcagctcaaaacctac
tcgctcgggtttgtgggggagggcgccgcggagctcgatgagttgccgctcgcgcgagcg
gtcgcgcagcggtgggggaccgaccatcatgaattggtgctccagccggaagacctgcta
cgggatttgctcaaaatggtgtgggcattggatgagccctacggcggtgggctgccgtcc
tggtacgtgtttcagttcatgcagcaagacgtcaaggtcgggatgacgggaaccggcggt
gatgaactgttcggagattacgggcgatacattcagctggaacagcggacttcaccggga
acacaggccgctccgctgccggcgtggctggagcgcggctggccgttggttgcgtcgctg
gtcgaccagattccgcatggcatcggaggtttacgaaggaaggagcgatggcgtcactat
ccggaggcgcggcgcgatccgttcggatgggactacgtgcaagccttctattatctctcc
gagtccatgaaacggactgcggtcctgacgtcgccgtcggacggaagaatcattcaagac
acggtagagctgttgcgagaccattaccgggagtcccagagcgagcagccccgcgatgcg
gtcatgcatctggcgatgcagacgcagttgccggaagagttcctgtgtatgaccgatcgg
ttttcaatggcccattcgttggaggcgcgcgtgccgttcttggatcacctgttcgtcgag
gcggtcatgcgtattccggcccagatccggacgaagccggaggaccccaagtacttgctc
cggcaggccgtgcgcgatctgttgcccgatgacctgctgcatgcgccgaagcgcgggttc
gtgatccctacggcccggtggttacgcggaccgctccgtccgttggctgaacggctactt
gcgcccgccaggctggccgagcagggaatattccgacccgagttttatgcgcgtttcgtt
caaccccatgttgaaggccgggcggactaccatccgcaggtctggacggccctcatgttt
cagctctggcacaatctgtatatcgaacaggccctgaccgaatgtccgcatttttcctgg
caggagctctgccgctag

DBGET integrated database retrieval system