KEGG   Nitrospira defluvii: NIDE3045Help
Entry
NIDE3045          CDS       T01281                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nde  Nitrospira defluvii
Pathway
nde00040  Pentose and glucuronate interconversions
nde00052  Galactose metabolism
nde00500  Starch and sucrose metabolism
nde00520  Amino sugar and nucleotide sugar metabolism
nde01100  Metabolic pathways
nde01130  Biosynthesis of antibiotics
Module
nde_M00362  Nucleotide sugar biosynthesis, prokaryotes
nde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NIDE3045 (galU)
   00052 Galactose metabolism
    NIDE3045 (galU)
   00500 Starch and sucrose metabolism
    NIDE3045 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NIDE3045 (galU)
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NIDE3045 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: CBK42741
UniProt: D8PHK4
Position
2997520..2998461
Genome map
AA seq 313 aa AA seqDB search
MTRTDVRKAIIPAAGLGTRFLPATKASPKEMLPLVDKPLIQYVVEEAVASGIEDIIVITG
RGKRAIEDHFDRSLELEENLKGSGKGQVLNQMRHISNLANFCYVRQPEAMGLGHAVLCAQ
HLIGDEPFAVILGDEIIDAAVPGLAQLIHIYKQRKGAVLGVQEVPPQEVSRYGIISARGL
GKGLHRVDDLVEKPAPADAPSNLAVIGRYVLPPEIFPILRKTPPGKNGEIQLTDALRQLV
KHTPMFAHEIEGQRHDAGDKLGFLIATVELALKNPSLGPAFGEFLQQRLRPTAADVRRRG
PSRSGQGRTRTTN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaacagatgtacgtaaagctattattcccgctgccggactgggcactcgcttc
ctccccgccaccaaagcctctcccaaagagatgctgccgctggtcgacaaaccgctgatt
cagtacgtcgtggaagaagccgtcgcatccggtatcgaagacatcatcgtcatcacgggc
cgcggcaagcgcgcgatcgaagaccacttcgaccgctctctggaactggaagaaaatctc
aagggcagcggcaaggggcaggtgctcaaccagatgcggcacatttcgaatctggcaaac
ttctgttacgtccgccagccggaagccatgggcctcgggcacgcggtgctctgcgcccag
cacctgatcggcgatgagccgttcgccgtcattttgggcgatgaaatcatcgacgcggcg
gtccccggcctcgcccagctcattcatatttacaagcaacgcaaaggcgccgtcctgggc
gtgcaggaagttccgccccaggaggtgagtcgctacggcatcatctcggcccgaggcctg
ggcaaagggctgcaccgggtcgatgacctggtcgagaaacccgcgcccgccgatgcgccg
tcgaatctcgccgtcatcggccggtatgtcttgccgccggagatcttcccgatcctccgc
aagacgcctccgggtaagaacggagaaattcagttgaccgacgccttgcggcaactcgtc
aagcacaccccgatgttcgcccacgaaatcgagggacagcggcacgatgcgggcgacaaa
ctcggattcctcattgccaccgtggaattggcgctcaagaatccgtccttgggacctgcg
ttcggcgagttcctgcaacaacgactccgaccgaccgccgccgacgtgcgtcgccgcggc
ccaagccgatccggccaaggtcgaacacgcaccaccaactag

DBGET integrated database retrieval system