KEGG   Candidatus Nitrospira defluvii: NIDE3045Help
Entry
NIDE3045          CDS       T01281                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NIDE3045 (galU)
   00052 Galactose metabolism
    NIDE3045 (galU)
   00500 Starch and sucrose metabolism
    NIDE3045 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NIDE3045 (galU)
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NIDE3045 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2997520..2998461
Genome map
AA seq 313 aa AA seqDB search
MTRTDVRKAIIPAAGLGTRFLPATKASPKEMLPLVDKPLIQYVVEEAVASGIEDIIVITG
RGKRAIEDHFDRSLELEENLKGSGKGQVLNQMRHISNLANFCYVRQPEAMGLGHAVLCAQ
HLIGDEPFAVILGDEIIDAAVPGLAQLIHIYKQRKGAVLGVQEVPPQEVSRYGIISARGL
GKGLHRVDDLVEKPAPADAPSNLAVIGRYVLPPEIFPILRKTPPGKNGEIQLTDALRQLV
KHTPMFAHEIEGQRHDAGDKLGFLIATVELALKNPSLGPAFGEFLQQRLRPTAADVRRRG
PSRSGQGRTRTTN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaacagatgtacgtaaagctattattcccgctgccggactgggcactcgcttc
ctccccgccaccaaagcctctcccaaagagatgctgccgctggtcgacaaaccgctgatt
cagtacgtcgtggaagaagccgtcgcatccggtatcgaagacatcatcgtcatcacgggc
cgcggcaagcgcgcgatcgaagaccacttcgaccgctctctggaactggaagaaaatctc
aagggcagcggcaaggggcaggtgctcaaccagatgcggcacatttcgaatctggcaaac
ttctgttacgtccgccagccggaagccatgggcctcgggcacgcggtgctctgcgcccag
cacctgatcggcgatgagccgttcgccgtcattttgggcgatgaaatcatcgacgcggcg
gtccccggcctcgcccagctcattcatatttacaagcaacgcaaaggcgccgtcctgggc
gtgcaggaagttccgccccaggaggtgagtcgctacggcatcatctcggcccgaggcctg
ggcaaagggctgcaccgggtcgatgacctggtcgagaaacccgcgcccgccgatgcgccg
tcgaatctcgccgtcatcggccggtatgtcttgccgccggagatcttcccgatcctccgc
aagacgcctccgggtaagaacggagaaattcagttgaccgacgccttgcggcaactcgtc
aagcacaccccgatgttcgcccacgaaatcgagggacagcggcacgatgcgggcgacaaa
ctcggattcctcattgccaccgtggaattggcgctcaagaatccgtccttgggacctgcg
ttcggcgagttcctgcaacaacgactccgaccgaccgccgccgacgtgcgtcgccgcggc
ccaagccgatccggccaaggtcgaacacgcaccaccaactag

DBGET integrated database retrieval system