KEGG   Candidatus Nitrospira defluvii: NIDE3103Help
Entry
NIDE3103          CDS       T01281                                 

Definition
putative 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nde01200]
Metabolism; Overview; Fatty acid metabolism [PATH:nde01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nde00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nde00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:nde00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nde01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:nde00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nde00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:nde00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:nde00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:nde00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:nde00281]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:nde00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3059468..3060691)
Genome map
AA seq 407 aa AA seqDB search
MYIYKVGVVGAGTMGAQIAEVVSFAGVPVLLADIQESLARRGVESVRAIYQARVDKSKMT
PEQLEEKMLLVTASPNLEALNDVDLVIEAVSEEVTLKQRLFRELDRVCARSAILASNTSA
LSISAIGASTTRPGKVLGLHFFNPAYAMPLVEVIPGLATDPQTVDDVVGFAESLRKTPVI
VKECAGFLVNRLLSPYLNEAVWCFQDGDVSIKEIDQDMVAFGMPVGPFTLLDTVGLDIAL
EVARILHRSYGPRMAPAPLLEALVKAGRWGIKSGRGFYEYSGGEERSGDQALDSLLQQVR
QSGGQTGMEWTRLRPLLAMVNEAVIAYQEGVASARDIDLAMVAGTGFPNEKGGPLHVADQ
LGIDHVLHELEALRDTLGLRFWPAPMLRRMVDAGFTGQLAGRGFFAY
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtacatctataaagtcggtgtggtgggtgccgggaccatgggcgcgcagattgctgaa
gtggtgagttttgccggcgtgccggtgctgctggcagatatccaggaatcactggccagg
cgaggcgtcgaatccgtgcgggcgatctatcaagcccgcgtggacaaaagcaagatgacg
cctgagcagctggaagagaaaatgttgctggtgacggcctcgcccaacctcgaggcgctt
aatgatgtcgatctggtcatcgaggcggtctcagaagaggtcacgctgaaacagcgcctg
ttccgcgaactggaccgggtctgtgcgcgaagcgccatcctggccagcaacacctccgcg
ctgtccatctcagccatcggggcttcaaccacgaggcccgggaaggtgctcggacttcat
tttttcaatcctgcctatgcgatgccgctggtggaggtcatccccggcctggccacggat
ccccagactgtcgatgatgtcgtcggttttgccgaaagccttcgcaagacgccggtgatc
gtgaaggaatgcgcaggtttcctcgtcaatcgtctgctctctccctatctgaatgaagcc
gtgtggtgcttccaagacggcgatgtgtccatcaaggagatcgatcaggacatggtggca
ttcggcatgccggtcggcccattcacgctgctggataccgtcgggctggatattgcgctc
gaagtcgcgcgcattctccaccgatcctacggaccacggatggcgccggcgccgcttctc
gaagccttggtcaaggcggggcgatggggaatcaaatcggggcggggcttctacgagtat
tcgggaggcgaggaacggagcggcgatcaggccctcgattctctgctgcagcaagtgcgg
cagagtggcgggcagaccgggatggaatggaccagattacgccctctccttgccatggtg
aatgaggcggtgattgcgtaccaggagggcgtcgcgtcggcgcgagatatcgatctggcg
atggtggcgggaaccggatttcccaacgagaagggaggaccgctgcatgttgccgaccag
ctcgggatcgaccatgtgttgcatgaattggaagcgttgcgagatacgctgggcctacgc
ttctggccggcgccgatgttgcgccgaatggtcgacgccggcttcaccggacagctcgcg
ggacgagggttctttgcctattaa

DBGET integrated database retrieval system