KEGG   Candidatus Nitrospira defluvii: NIDE3115Help
Entry
NIDE3115          CDS       T01281                                 

Definition
putative branched-chain alpha-keto acid dehydrogenase, dihydrolipoamide acyltransferase (E2) component (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE3115
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIDE3115
  Amino acid metabolism
   00310 Lysine degradation
    NIDE3115
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NIDE3115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3070280..3071437
Genome map
AA seq 385 aa AA seqDB search
MATDIVMPQLGESIAEGTVVRWLIPQGGAVEKDQPLLEVETEKVALDIPSPATGFLTEIL
VPEGTTVPVGTMLAKLDTQPASGVVNRVGGVTVRPMEAAQGERHYSPAVRQLAKEHGLDL
SAITGTGEGGRVTKHDLLDVIGTRESTGRVQKTLAATPSPPPASTIEEIVPLSQMRKTIA
ERMVLSRHTAAHVATFFEADFSGVAGFREGRALTYLPFVVSAVTRAIREHPLLNSSWREQ
GLVMKNDRHIGIAVALDDGLLVPVIRHADRKGLNQIAHEITDLADRARSKRLRPEEVQDG
TFTITNHGGFGSLFSTPIINQPQTAILGVGSVQKRAVVINDAIAIRTMCYLSLSFDHRVI
DGATADRFMARVKQHLEESDWEKLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccgacattgtgatgcctcaactcggtgaaagcatcgcggaagggaccgtcgtc
agatggctgatccctcaaggcggagccgtcgaaaaagatcagccgctcctggaagtggaa
accgagaaggtcgccctggacattccctcacccgcgacagggttcctcaccgagatactc
gtgcctgaaggaacaaccgttccggtaggaaccatgctggccaagctcgatactcaaccg
gcatcgggcgtcgtcaatcgtgtcgggggcgtgacggtccggccgatggaggcagcgcag
ggcgagcgtcactactcacccgccgttcgacaactggcgaaagaacatggcctggatctc
tccgcgatcacaggaaccggcgagggcgggagagttacgaagcatgacctgctcgacgtg
atcggcacgcgtgaatcgaccggcagggtgcagaagacgttggctgcaacgccatccccg
cctcccgcctccacgattgaagagatcgtgcccctctctcaaatgcgaaagaccatcgcc
gagcgcatggtcctgagccgtcacacagcagcccatgtggcgacatttttcgaagcggac
ttcagcggcgtggccggattccgcgaaggccgcgcgctcacctatctgccgttcgtggtc
agcgccgtcactcgcgctatcagagagcatccgcttctgaattcctcctggcgggagcag
ggactcgtgatgaagaacgacaggcatatcggcatcgcagtggcactcgatgacggcctg
ctggttcccgtcattcggcatgccgatcgcaaaggactgaaccagattgcccatgagatc
acagaccttgccgaccgagccaggagcaagcggttacgaccggaagaagtccaggacggc
accttcaccatcaccaaccatggaggtttcggcagcctcttcagcacccccatcatcaat
caaccccaaaccgccatcctcggagtgggatcggtgcagaaacgcgcggtcgtcatcaac
gatgccatcgcgattcgcacgatgtgttacctgagcctctcgttcgaccatcgggtgatc
gacggcgccaccgccgaccgcttcatggccagggtgaaacagcatcttgaagaaagcgac
tgggagaaactgttgtga

DBGET integrated database retrieval system