KEGG   Candidatus Nitrospira defluvii: NIDE3115Help
Entry
NIDE3115          CDS       T01281                                 

Definition
putative branched-chain alpha-keto acid dehydrogenase, dihydrolipoamide acyltransferase (E2) component (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE3115
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIDE3115
  Amino acid metabolism
   00310 Lysine degradation
    NIDE3115
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NIDE3115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3070280..3071437
Genome map
AA seq 385 aa AA seqDB search
MATDIVMPQLGESIAEGTVVRWLIPQGGAVEKDQPLLEVETEKVALDIPSPATGFLTEIL
VPEGTTVPVGTMLAKLDTQPASGVVNRVGGVTVRPMEAAQGERHYSPAVRQLAKEHGLDL
SAITGTGEGGRVTKHDLLDVIGTRESTGRVQKTLAATPSPPPASTIEEIVPLSQMRKTIA
ERMVLSRHTAAHVATFFEADFSGVAGFREGRALTYLPFVVSAVTRAIREHPLLNSSWREQ
GLVMKNDRHIGIAVALDDGLLVPVIRHADRKGLNQIAHEITDLADRARSKRLRPEEVQDG
TFTITNHGGFGSLFSTPIINQPQTAILGVGSVQKRAVVINDAIAIRTMCYLSLSFDHRVI
DGATADRFMARVKQHLEESDWEKLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaccgacattgtgatgcctcaactcggtgaaagcatcgcggaagggaccgtcgtc
agatggctgatccctcaaggcggagccgtcgaaaaagatcagccgctcctggaagtggaa
accgagaaggtcgccctggacattccctcacccgcgacagggttcctcaccgagatactc
gtgcctgaaggaacaaccgttccggtaggaaccatgctggccaagctcgatactcaaccg
gcatcgggcgtcgtcaatcgtgtcgggggcgtgacggtccggccgatggaggcagcgcag
ggcgagcgtcactactcacccgccgttcgacaactggcgaaagaacatggcctggatctc
tccgcgatcacaggaaccggcgagggcgggagagttacgaagcatgacctgctcgacgtg
atcggcacgcgtgaatcgaccggcagggtgcagaagacgttggctgcaacgccatccccg
cctcccgcctccacgattgaagagatcgtgcccctctctcaaatgcgaaagaccatcgcc
gagcgcatggtcctgagccgtcacacagcagcccatgtggcgacatttttcgaagcggac
ttcagcggcgtggccggattccgcgaaggccgcgcgctcacctatctgccgttcgtggtc
agcgccgtcactcgcgctatcagagagcatccgcttctgaattcctcctggcgggagcag
ggactcgtgatgaagaacgacaggcatatcggcatcgcagtggcactcgatgacggcctg
ctggttcccgtcattcggcatgccgatcgcaaaggactgaaccagattgcccatgagatc
acagaccttgccgaccgagccaggagcaagcggttacgaccggaagaagtccaggacggc
accttcaccatcaccaaccatggaggtttcggcagcctcttcagcacccccatcatcaat
caaccccaaaccgccatcctcggagtgggatcggtgcagaaacgcgcggtcgtcatcaac
gatgccatcgcgattcgcacgatgtgttacctgagcctctcgttcgaccatcgggtgatc
gacggcgccaccgccgaccgcttcatggccagggtgaaacagcatcttgaagaaagcgac
tgggagaaactgttgtga

DBGET integrated database retrieval system