KEGG   Candidatus Nitrospira defluvii: NIDE3182Help
Entry
NIDE3182          CDS       T01281                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE3182 (pfkA)
   01230 Biosynthesis of amino acids
    NIDE3182 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE3182 (pfkA)
   00030 Pentose phosphate pathway
    NIDE3182 (pfkA)
   00051 Fructose and mannose metabolism
    NIDE3182 (pfkA)
   00052 Galactose metabolism
    NIDE3182 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    NIDE3182 (pfkA)
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NIDE3182 (pfkA)
Protein phosphatases and associated proteins [BR:nde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NIDE3182 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3144151..3145416)
Genome map
AA seq 421 aa AA seqDB search
MGTIKQRPVVAILVGGGPAPGINSVIGAATIRSILGGCDVIGIQDGFKWIMDGQTSKVKR
LSIEDISRIHFSGGSCLGTARANPTQKLEHLDACLTSLNTLGVTRLITIGGDDTAFSALR
LEQRAAGRLQVVHVPKTIDNDLDLPHGIPTFGFQTARHIGVELVKSLMVDAETTSRWYFV
VTMGRKAGHLALGIGKAAGATLTVIPEEFRQKPLRLKTLVDVLIGAFIKRLNAGRSDGVA
VLAEGLVESLAQEDLEGLQDVERDQHGHVRLAEINFGFVLKRAVEKELRSFGIKTTIVEK
NIGYELRCADPISFDMEYTRDLGYCAAQFLLDGGNAAMVSIQNGRFIPIPFGDILDPATG
RTRVRMVDVESESYVIARRYMIRLAPDDFNQPQGLVRLATTAGLAVDDFRKRFEYLMGKD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccatcaagcaacgaccggtggtggcgattcttgtcggaggagggccggcgccc
ggcattaacagtgtcatcggggccgcgacgattcgaagcattcttggtgggtgcgacgtg
atcggcattcaagacggtttcaaatggatcatggatggccagaccagcaaggtgaagcgc
ctgtcgatcgaagacatcagccggattcacttcagcggcggctcctgccttggcacggcg
cgcgcgaaccccacccagaaactcgagcatctggatgcctgcctgacgagtctgaacaca
ctcggcgtgactcgattgatcacgatcggaggtgacgataccgcgttctccgcgctgagg
ttggaacagcgggccgccggtcgcctccaggtcgtgcatgtgccgaagaccatcgataac
gatctggacctgccccacggcattccgacgttcggattccagacggcgcgccacatcggc
gttgagctcgtgaagagtttgatggtagatgcggagacgacttcacgctggtatttcgtg
gtgacgatggggcgcaaggccgggcatctggcactcgggatcgggaaggcggccggcgct
acgttgacggtgattcccgaggagtttcgtcagaaacctctccgtctgaaaacgctggtc
gatgtcctgatcggtgcgttcatcaagcggctcaatgccggacgatcggacggcgtggcg
gtcctggctgaaggcctcgtggaaagcctcgcgcaggaggatctcgagggtctgcaggat
gtggagcgggaccagcacggacatgtgcggctggcggagatcaacttcggtttcgtgctc
aagcgggcggtcgagaaggaactgcggtctttcggcatcaagaccaccattgtcgagaag
aacatcgggtacgagcttcgctgcgccgatcccatttcgttcgatatggaatatacccgc
gatctcggttattgcgcggcgcagtttctcctggatggcgggaatgccgcgatggtgtcg
attcaaaacggccgcttcattcccattccgttcggcgacattctggacccggcgaccggc
cgtaccagggtgcgcatggtggatgtggaatcggagtcgtacgtcattgcaaggcggtac
atgattcgcttggctccggatgatttcaatcagcctcaggggctggtccgtttggccacc
acggccggtctggccgtggatgatttccggaaacggttcgaatatctgatgggcaaggat
ctgtga

DBGET integrated database retrieval system