KEGG   Candidatus Nitrospira defluvii: NIDE3768Help
Entry
NIDE3768          CDS       T01281                                 

Definition
putative 1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NIDE3768
Enzymes [BR:nde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NIDE3768
Exosome [BR:nde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NIDE3768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3751245..3753155)
Genome map
AA seq 636 aa AA seqDB search
MPASLNHIHPGTPMGANLIAGGATFRCWAPHAKSVHVVGDFNHQGRNEASLLTRDAQGHW
RGFIPGVKDRQRYMFYVVGEGSEGLKRDPYARELESPFPSQCIIRHPDFPWHECGYVTPR
FHEYVIYQLHVGTFFTPNLPRKGGTFLDVARKLPYLADLGVNALQLMPIQEFQTSFSLGY
NGTDYFSPEMDFAVSDADLAPYVAAVNRLLEEKGLRPYQVKELRGEMNQLKALIDLAHVY
GLAVLLDVVYNHAGGDFGDQSLYFFDRQHPAGGQRNSLYFTDTGHAGGLVFDFAKPEVRD
FLIQNAKFFLTEYRVDGFRYDQVSVIDHDGAPEGWRFCQDLTSTVHAQRPETVHHAEYWD
VNPFIVAPPPVGAGFDTTLTDGLRIAIRDVIGNASAPDERPLNMTGLARSLWPEGFHEPW
RFVQGPENHDIVYRGREQRIARLGDPDHPRSWFARSRARVATGLSLTAPGIPMLFMGQEF
LEDKQWADDFATHRELLLHWAGLEQGDRQMIDHLRFTRDLLQVRRRLPALRGQGFRAAHV
HDQNRVLTFHRWVEGQGHDLLVVVHLADFTRVGYRLGFPAGGDWREVFNSDAYENWINAG
VAGNSGRVTAGPQPLHGFAYSAAVVLPANSMLIFAR
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgtcactcaaccacattcatcccggtaccccgatgggggccaatctgattgcc
ggcggcgcgacgttccgttgctgggctccgcatgccaagtccgtccacgtggtcggcgat
ttcaaccatcagggacggaacgaagcgagtttgctgacgcgggacgcgcaggggcattgg
cgtgggtttatcccgggggtgaaagatcgccagcgctacatgttctacgtggtcggcgag
ggcagtgaggggctcaagcgggatccctatgcccgcgagttggagtcgcccttccccagc
caatgcatcattcgtcacccggactttccctggcacgagtgcggctatgtcacgccgcgt
tttcatgaatacgtcatctatcagctccatgtgggaacgttcttcaccccgaatctcccg
cggaagggcggcaccttcctcgatgtggctcgcaagctgccctatctcgccgacctcggg
gtgaatgcgctgcaactgatgcccattcaggagtttcagaccagcttcagcctgggctac
aacggcaccgactatttttctcccgaaatggactttgccgtgtcggatgccgatctggct
ccctatgttgcggcagtcaaccggctgctcgaggagaaaggattgcgcccgtaccaggtg
aaggagctcaggggagaaatgaatcagctcaaggcgctgatcgatctcgcccatgtctat
ggcctggcggtgctgctcgatgtggtctacaaccatgcgggcggagacttcggggaccag
agcctgtatttcttcgatcgacaacatccggccggcgggcagcgcaactcgctgtacttc
accgatacaggccatgccggcggtctggtgttcgactttgccaagcctgaggtgcgcgac
ttcctgattcagaatgccaaattcttcctcacggaataccgggtcgatggcttccggtac
gaccaggtgagcgtgatcgatcacgacggggcgcccgagggctggcgcttttgccaggac
ctgacctcgacggtgcatgcgcagcggccggagacggtgcaccatgcggaatattgggat
gtgaatccgttcatcgtcgcgccgcctccggtcggggccggtttcgacaccaccttgacc
gacggcctgcggattgcgattcgcgatgtcatcggcaacgcgagtgcgcccgacgagcgc
ccactgaatatgacagggctggcaagaagcttgtggcccgaggggttccacgagccgtgg
cgttttgtgcaggggccggagaatcacgacatcgtttaccggggtcgtgaacagcgcatt
gcccggctcggcgatccggaccatccccgatcctggtttgcgcgcagccgtgcgcgggtc
gcgaccggcctcagcctcacggcccccggcattcccatgctgttcatgggacaggaattt
ctggaggacaagcagtgggcggacgacttcgcgacgcaccgcgagctgctgctccattgg
gccggtctcgaacagggcgaccggcagatgatcgaccatctgcggttcacgcgggacctg
ttgcaggtgcgccgccgattgccggcgttgcgtggacaggggtttcgtgcggcgcatgta
cacgatcaaaaccgggttctgacgtttcatcgctgggtggaaggccaagggcacgacctg
ttggtggtggtgcacctggccgatttcacccgtgtcgggtatcgactcgggtttccagca
ggtggagactggcgcgaagtgttcaacagcgatgcctatgaaaactggatcaacgccggc
gtggccggcaacagcgggcgcgtgaccgccggtccgcaacccctgcacggcttcgcctac
tcggccgcggtggtgctccctgccaatagtatgctgatatttgcgcgttag

DBGET integrated database retrieval system