KEGG   Candidatus Nitrospira defluvii: NIDE3854Help
Entry
NIDE3854          CDS       T01281                                 

Definition
putative pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase (E2) component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE3854
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE3854
   00020 Citrate cycle (TCA cycle)
    NIDE3854
   00620 Pyruvate metabolism
    NIDE3854
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIDE3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3828606..3829778
Genome map
AA seq 390 aa AA seqDB search
MAEFLMPTLGADMTDGTLVQWKKKEGDRIAKGETIAEVDTEKAAIDVESHTTGIIERLIT
RPGDKVPVGTVMAIIREEGGPTTSVASPRAVATPPSPPPPSPRTERAAVAPSQVGRLRIS
PAAKKLAAERGIEASTLQGTGPEGAITLDDIDRATTATTDIAKPVGTADRQARMRQTIAA
AMARSKREIPHYYLSTTIDMGRAITWLKDSNEQRPVTERLLYGVLLIKAVALALRRVPEL
NALWKDGEAHRSERIHIGTAISLRQGGLVAPALHDADRLSLSELMQNFQDLVKRARAGSL
RSSELSDPTITVTSLGEQGVETVFGVIYPPQVALVGFGKVVERPWVADGLVVPRPVLMAS
LSADHRVTDGHRGGLFLAEIDRLLQEPQSL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattcctgatgccgaccctcggcgccgacatgaccgacggcaccttggtgcaa
tggaaaaagaaagaaggtgaccgcatcgccaaaggcgagaccatcgcggaggtcgatacg
gagaaggccgccatcgacgtcgagtcccataccacaggcatcatcgagcgactcatcacc
agaccgggcgacaaggttccggtcggcacggtcatggcgatcattcgcgaagagggaggc
ccgacaaccagtgtcgcttctccccgggcggtcgccactccaccgtccccccctccgccc
tcccctcgaacggagcgcgcagccgttgcgccatctcaggtcgggcgattgcggatttca
ccggcggcgaaaaaactggccgccgagcgaggcatcgaggcaagcacgttgcagggaacc
ggcccggaaggagccatcaccctcgacgatattgatcgcgccaccacggcaacgacggac
atcgccaaaccggtcggtaccgccgaccgccaggcacgcatgcggcaaaccatcgccgca
gccatggcccgatccaaacgcgaaatcccccactattacctcagcaccaccatcgacatg
ggccgggcaatcacctggctgaaggactcgaacgagcagcgtcccgtcacggagcgtctt
ctctacggtgtcttgctgatcaaagcggtcgccctcgcgctccgccgggttcccgagctc
aatgcgctgtggaaggacggcgaggcccaccggagcgaacggattcatatcggcaccgcc
atttccctccgtcagggtggactggtcgcgccggcgttgcacgacgccgatcggctgagc
ctcagcgagttgatgcagaactttcaggacctggtgaagcgcgcccgggccggttcgtta
cggagctcggaactgtccgacccgaccatcaccgtcacgagtctcggggaacagggagtg
gaaactgtgttcggagtcatttatcctccacaagtcgcgctggtcggattcggcaaagtc
gtcgaacgcccctgggtcgccgatggcctggttgtgccgaggccggtgctcatggcgtcg
ctctccgccgaccaccgcgtcacggacggccaccgcggaggattgttcctggctgagatc
gatcgcctgttacaggagccccagtcgttatga

DBGET integrated database retrieval system