KEGG   Nitrospira defluvii: NIDE3874Help
Entry
NIDE3874          CDS       T01281                                 

Gene name
vorA
Definition
(GenBank) 2-ketoisovalerate ferredoxin reductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
nde  Nitrospira defluvii
Pathway
nde00010  Glycolysis / Gluconeogenesis
nde00020  Citrate cycle (TCA cycle)
nde00620  Pyruvate metabolism
nde00640  Propanoate metabolism
nde00650  Butanoate metabolism
nde00680  Methane metabolism
nde01100  Metabolic pathways
nde01120  Microbial metabolism in diverse environments
nde01130  Biosynthesis of antibiotics
nde01200  Carbon metabolism
Module
nde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE3874 (vorA)
   00020 Citrate cycle (TCA cycle)
    NIDE3874 (vorA)
   00620 Pyruvate metabolism
    NIDE3874 (vorA)
   00640 Propanoate metabolism
    NIDE3874 (vorA)
   00650 Butanoate metabolism
    NIDE3874 (vorA)
  Energy metabolism
   00680 Methane metabolism
    NIDE3874 (vorA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIDE3874 (vorA)
Enzymes [BR:nde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIDE3874 (vorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: CBK43547
UniProt: D8PJH3
Position
complement(3843813..3845051)
Genome map
AA seq 412 aa AA seqDB search
MDSQMMTGNLAAAWGARLADVDYIPAFPITPQTEIVEALAKWCEGGELAARFVTMDSEHS
MMTAAGAAEATGARVFTATSSQGLLYAFEVLYSISGWRAPLVLVNVSRALAAPITLESDH
NDVLAARDSGFLQIHAETCQEVLDSILMAYRIAEDERVMLPVIVNLDGFSLSFTREPVSL
PDPEQVRKFLPPFRPAHLGFRASAPHSLGVAVIGGTPYAYFRHQMHLASINALEVHREAA
ASFEQLFGRRYDVVEGYRLDDAEDVLVMTNACSSTGKAAVDVARAEGKRVGLLRLRMIRP
WPADAIRDALRGRRAVAVLDQNLAPGQGGILFQEMAASLYHEVERPRALCSFIGGLGGQN
LSVGAFHAIFEQTAKAGVSGKGIGPVLLYTQAEHREMTQLQMVAAGSVKRET
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagatgatgaccggcaacctggcggcggcctggggagcgaggctggccgac
gtggattacatccctgcgtttcccatcacgccgcaaacggaaattgtggaagcgctggcc
aaatggtgcgaaggcggtgagctggcggcgcggttcgtcacgatggactctgagcattcg
atgatgacggcggcgggcgcggcggaggccacgggggcccgggtcttcaccgccacatcc
agccaggggttgctctacgccttcgaagtgctctattcgatctcgggctggcgcgcgccg
ctggtgctcgtcaacgtatcgcgggcactggctgcgcccattacgttggagtccgatcat
aacgatgtgttggccgcacgcgattcgggttttttgcagatccacgccgaaacctgccag
gaggtgctggattcgattctgatggcctatcggattgcagaagatgagcgggtgatgttg
ccggttatcgtgaatctggacggcttttcgctgtcgttcacgcgtgaaccagtgagcctc
ccggacccggagcaggtgcggaagtttctgcctccgttccgtcccgctcacctagggttc
agagcatctgcgccccattcgttaggggtggcggtgatcggcgggacgccatacgcctat
ttccggcatcaaatgcatctggcctcgatcaatgccctggaggtgcaccgtgaagccgct
gcgtccttcgaacagttgtttggtcggcggtacgatgtggttgaggggtatcggctggac
gatgcggaggatgtgctcgtgatgacaaatgcctgttcgagcacgggcaaggcggcggtc
gatgtagccagggcagagggtaaacgggtgggcctgttgcggcttcggatgattcgaccc
tggccggcggatgccatccgtgacgcattgcgggggcgtcgggccgtggccgtgttggat
cagaatctcgcgccggggcagggtggcattctgtttcaggagatggccgcctctctgtat
cacgaagtcgagcggccgcgggcactctgttccttcatcggagggctcgggggacagaat
ctgtcggtgggggcgtttcacgcgatcttcgagcaaacggcgaaagccggagtcagcgga
aaaggcatcggtcctgtccttctctacacgcaagccgaacatcgggagatgactcagctc
cagatggtggcggcaggaagcgtgaaacgtgaaacgtga

DBGET integrated database retrieval system