KEGG   Nitrospira defluvii: NIDE3951Help
Entry
NIDE3951          CDS       T01281                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoamide acetyltransferase (E2) component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nde  Nitrospira defluvii
Pathway
nde00010  Glycolysis / Gluconeogenesis
nde00020  Citrate cycle (TCA cycle)
nde00620  Pyruvate metabolism
nde01100  Metabolic pathways
nde01110  Biosynthesis of secondary metabolites
nde01120  Microbial metabolism in diverse environments
nde01130  Biosynthesis of antibiotics
nde01200  Carbon metabolism
Module
nde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE3951 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NIDE3951 (pdhC)
   00620 Pyruvate metabolism
    NIDE3951 (pdhC)
Enzymes [BR:nde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NIDE3951 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N HlyD_3 PYNP_C AATase
Motif
Other DBs
NCBI-ProteinID: CBK43621
UniProt: D8P7Y9
Position
complement(3917220..3918422)
Genome map
AA seq 400 aa AA seqDB search
MASRVVMPKLTDTMEEGVLLAWKKREGDRVHAGEVIAEIETDKAVMDLEAFAPGILRKIL
VRDGETVQSGTLIAVIAEADEDITAALSDGVTAAPSIGSGAKTGAAPGEVSAPVTAARPE
GARPFASPRAKALAAERGIDLSALTGSGPGGRIVEDDVRQATAQPAPALPAGIDQPLSQM
RKAIARATVQSKAPVPHFYLTVEIDMEQAERVRDQFKQSRQTHPSVTDLLIKAAALALRR
HPEINVSFAGDAIRRFEQIDIGVAVGMEDGLITPVIRDCGAKTLTEISAETKSLIERARQ
KRLQPQEYTGATFAISNLGMFDVDNFIALLMPPQAASIAVGAIRDVPVVTKGTVTAGRRM
KVTMSCDHRALDGLMGAQFLKEFKRVLEHPQELVAPVVNP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcgcgtggtcatgcccaaactgacggatacgatggaagagggtgtgctcctg
gcctggaagaagcgcgaaggtgatcgggtgcacgcaggcgaagtgatcgccgagattgaa
accgataaggcggtcatggatctggaagcctttgcccccggcatcctgcgcaagattctc
gtgcgagatggtgaaaccgtgcagtccggcacgttgatcgcggtcatcgccgaggctgat
gaagatatcacggcggccttgtccgacggcgtgacggccgcgccatcgatcggcagtggc
gcgaagaccggtgccgcgcccggagaggtctctgccccggttacagcggctcgtccggag
ggcgctcgtccattcgcctctccgcgagcgaaagccctggctgctgaacggggcatcgat
ctttccgcccttacgggcagcggtccgggtgggcgaattgtcgaagacgatgtgagacag
gcgaccgctcagcccgccccggcactgcctgccggaatcgatcagccgttaagccagatg
cgaaaagccatcgccagggcgacggtgcagagcaaggcgccggtccctcatttttatctg
acggttgaaatcgacatggagcaggcggagcgggtacgcgatcaattcaagcagagccgt
cagacccatccgtccgtcaccgatctgctcattaaggcagcggcattggcgttacgccgg
cacccggagatcaacgtctcctttgccggcgacgcgattagacggttcgagcagattgat
atcggggtggccgtcggcatggaggatggtctgattacgccggtgatccgagactgcggg
gcaaaaacgctcaccgagatttctgcggagaccaagtcgttgatcgaacgggccagacaa
aagcgcttgcagccgcaggaatatacgggggcgacgtttgccatctccaatctgggcatg
ttcgacgtggataactttatcgctctcctcatgccgccacaggctgcctcaattgccgtg
ggcgccattcgtgacgtgccggtcgtgacgaaaggaaccgtaacggccgggcggcggatg
aaggtcacgatgtcgtgcgatcatcgggcgctcgacggattgatgggcgcgcagtttttg
aaagagttcaaacgtgtgctggagcatccgcaggaactcgtggctcccgtggtgaacccg
tga

DBGET integrated database retrieval system