KEGG   Candidatus Nitrospira defluvii: NIDE4113Help
Entry
NIDE4113          CDS       T01281                                 

Gene name
thrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NIDE4113 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIDE4113 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NIDE4113 (thrC2)
Enzymes [BR:nde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NIDE4113 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4065879..4066937)
Genome map
AA seq 352 aa AA seqDB search
MIRWRGIIEEYRKFLPVTAQTPVITLGEGHTPLIRAARLAKKIAPGIDLYLKYEGMNPTG
SFKDRGMTMAISKAVEAGARAVICASTGNTSASAAAYGARAGIAVYVLIPAGKIALGKLS
QAMMHQATVIQVEGNFDQALTIVKELSATYPVELVNSLNPFRIEGQKTAAMEICDDLGDA
PAMHVLPVGNAGNITAYWNGYREYRAANQTTRLPRMMGFQAAGAAPIVLGHIVEEPQTVA
TAIRIGNPASWQSALTAVKESSGAIDMVTDEEILHAYALVASEEGVFCEPASATSVAGVI
KLSQAGQLKEGTTVVCTLTGHGLKDADTAIGISRQPQTVRATRDDVARLLHV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgattcgttggcgtgggatcatcgaagaataccggaagttcctgccggtcacggcgcag
acacctgtgatcacgctgggagagggccataccccactcatccgtgcggcgcggcttgcg
aagaagatcgctccggggatcgatctttatctgaagtatgaaggcatgaatcccaccggg
tccttcaaggatcgcggtatgaccatggcgatctccaaggccgtcgaagcgggcgcgcgg
gcggtcatttgcgcctccaccggaaacacgtctgcctccgctgccgcgtacggggccagg
gcgggcattgccgtgtatgtgctcattccggccggcaagatcgcgctgggcaaattgtcg
caggccatgatgcaccaggccaccgtcattcaagtcgaagggaattttgaccaggcgttg
accatcgtcaaagagttgtcggccacatatcccgttgagttggtcaattctctgaacccc
ttccggatcgaggggcagaaaacggcggccatggagatttgcgacgatctcggcgatgcg
ccggctatgcatgtacttcctgtagggaatgcaggtaatatcaccgcctattggaacggc
tatcgggagtatcgtgcggccaatcagacgacgcggttgcctcggatgatgggatttcag
gccgccggtgcggcgccgattgtcttaggccatatcgtcgaagagcctcagaccgtggcc
acggcgatcagaatcggcaatccggccagttggcaatcggctctcactgcggtgaaggag
tcgtccggcgccatcgatatggtcaccgacgaagaaattctgcatgcctatgccttggtg
gccagtgaggaaggtgtcttttgcgaaccagcatccgccacgtccgtggccggtgtcatt
aagttgagtcaggctggacaattaaaagaaggtaccacggttgtgtgtacgttgaccggg
catggtttgaaggatgccgatacggcgatcggcatttcacgacagcctcaaacagtgaga
gccacccgcgatgatgtggcccgcctccttcatgtctga

DBGET integrated database retrieval system