KEGG   Candidatus Nitrospira defluvii: NIDE4176Help
Entry
NIDE4176          CDS       T01281                                 

Definition
putative uroporphyrinogen III synthase HemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nde00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4125036..4125878
Genome map
AA seq 280 aa AA seqDB search
MASTGFNGLTVAAFESRMAAEMTRLIERHGGKPLVAPALREIPLEDNSVALRFGEQLLTE
GLDVLVLLTGAGTTTLFEILHSRHAKDTIKSALKETVLIARGPKPVAALKALGFQPTLTV
PEPNTWVDVVSTLDAHRPVNRLRVAVQEYGLPNRDLVEALKQRGATVVSVPVYRWALPEN
TAPLKQSIRQILDGQVQVMLVTNAAQIDHVMLVVEQEGKTEEFKTICRKLVIASIGPTAS
ERIRSHGLSVDFEPSHGKMGILVKETSEQAHSLMARKAGA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggccagtacagggtttaacgggctgaccgtcgccgcgtttgaatcgcgcatggcggcg
gaaatgacgcgactgatcgagcgccacggcggcaaaccgctggtggcgccggccttgcgg
gaaatcccgctcgaagacaattctgtcgcgctccggttcggtgagcagctgctgactgaa
ggtctcgacgtgctggtcctgctgaccggggccggcacgaccaccctcttcgaaatcctg
cacagccgtcacgccaaagacacgatcaagagtgctttgaaagagacggtgctcattgcg
cgcggccccaaaccggtagccgcactcaaagccctgggattccaaccgacgttgacggtc
ccggagcccaacacctgggtggatgtcgtctccacattggacgcccaccggccggttaac
cggttacgcgtggcggtgcaagaatacgggctgccgaaccgcgacttggtggaggcgttg
aagcagcgcggagccactgtggtttcagtccccgtctaccgctgggcgctcccggaaaac
acggctccgctcaagcagtccatcaggcagattctggacgggcaggtgcaggtgatgctg
gtgaccaatgccgcacagattgatcatgtgatgctggttgtcgagcaggaaggaaagacg
gaggagttcaaaacgatctgccggaaactggtcatcgcgtccatcggtcccaccgccagc
gaacgcatccgcagtcacgggctctccgtagacttcgaaccgtcacacggaaaaatgggg
attctggtaaaagagacgagcgagcaggcccactcgcttatggcgaggaaagcgggcgcg
tga

DBGET integrated database retrieval system