KEGG   Candidatus Nitrospira defluvii: NIDE4287Help
Entry
NIDE4287          CDS       T01281                                 

Definition
putative 6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nde  Candidatus Nitrospira defluvii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIDE4287
   01230 Biosynthesis of amino acids
    NIDE4287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIDE4287
   00030 Pentose phosphate pathway
    NIDE4287
   00051 Fructose and mannose metabolism
    NIDE4287
   00052 Galactose metabolism
    NIDE4287
  Energy metabolism
   00680 Methane metabolism
    NIDE4287
Enzymes [BR:nde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NIDE4287
Protein phosphatases and associated proteins [BR:nde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NIDE4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4220702..4223041
Genome map
AA seq 779 aa AA seqDB search
MSASDSQSTDQLHFVTMQGLLAYGEALAQRTSGERFVLPPPPPPAADRLSRAEEATGLIR
TFIQQAQAGLPSAEAYRTARQAVISDACGGDPLVFFAAWNRLLARGELAPLYRAPIGATQ
KPAHRRPVAIVPRTQLTPQLAEGRIVLDLGDDRFWLLPRDLGDRTLFLTMRHGVSEVESK
THRVGRRLANVLDADRGIPRAEAVGAALARMVGVVGQQLGYLQLRNYLDPRTFLHLISHS
PNTEQLCRRITKALIRDRTDAVHPHIEATLESQDFGWVTGMEKQAEIDMAAQAFGVDAKT
AKRLIKHPFYSYPGGHSFFDLYIDVIDGLHRLGRAHPGEVLCLYTHSSTLRALRIYLDPR
PFREAFSEFGEYKEGQDNVVLLTLENGKLSGYSTAVGLIESERVAREAWVTVERERSQRV
TLKPQRIKRLLALVSGGDFGGGGAALKELRVTGNRFGLEVFFVRHGFLGLANNWIDPVTE
EDTRGMGSHASSPIGSSRFEDFKDEEVQRAAMRSLAPYLADSALVVLGGDGSLRGARAIH
ETYGVQVVGIPGTIDNNIAGTTSLGFHSAIALANQSIESLKATSAAMGSIFFVEVMGAGS
GHLALACAYQARAEGILVNEHPDPDAYIEEIVLGTLKRTLGVPNKSHIFVVAERTPHRHH
REGGVHGLVDYVANTIATWPQRREKSGHYALATATKATILGHTLRGAPPTPEDKMIAQHL
AYETVRRLVEQPDTIVGCMVAYHDSNRLETIPLHAVAPKPFDWELFTRMHGTELAPDRV
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttcggacagtcagtcaaccgatcagttacactttgtcacgatgcaaggcttg
ctggcctacggtgaggccctcgcgcaacgcacatccggcgagaggttcgtgctgccgcct
cccccgccgcctgctgccgaccggctgtcccgcgccgaagaggcgaccggcctgatcaga
accttcatccaacaagcgcaggccggtctgcccagcgccgaggcctatcgcacggcacgc
caggccgtcataagcgacgcgtgcggaggcgacccgctggtcttctttgccgcctggaac
cggctcctggctcgcggcgaactcgccccattgtatcgcgcgccgatcggcgccacgcag
aagccagcgcatcgccgcccggtcgccatcgtgccacgcactcaattgaccccacagttg
gccgagggccgtattgtcctggatctgggtgatgaccggttctggctgcttccccgcgac
ctcggcgaccgcacgctgtttctcacgatgcgccacggggtctcggaagtcgagagcaag
acccatcgagtgggccggcggctggccaatgtcctggatgccgaccgcgggatacccagg
gcggaggccgtcggcgcggccctggctcgaatggtgggcgtggtgggacagcaattgggt
tatctgcagttgcgcaactatctggatccgcgcacgttcctgcatctcatcagccatagt
ccgaacacggaacaactctgccggcgcatcacgaaggccttgattcgcgaccggacggat
gccgtgcatccccacatcgaggccacgttggagtcgcaagatttcggctgggtcaccggc
atggaaaaacaggcggagatcgacatggccgcgcaggccttcggcgtcgatgccaagacc
gccaagcggctcatcaaacatcccttctatagctatccgggcgggcattcgttcttcgat
ctctatatcgacgtgatcgacggactacaccggctgggccgtgcccatcccggagaagtg
ctctgcctctatacccacagttcgaccctgcgcgcgctgcgtatctatctggacccgcgt
ccgttccgcgaagcgttttccgaattcggcgaatacaaggagggacaggacaatgtggtc
ctcctcacgctggagaacggtaaactctccggttactccacggccgtcggcctgattgaa
agtgaacgggtcgcccgcgaagcctgggtgacggtcgagcgggagcggagccagcgcgtc
acactcaagcctcaacgcatcaagcgcctcctggcactcgtgtcgggcggggatttcggc
ggcggcggggcggcgctgaaagaattgcgcgtgaccggaaaccgcttcggcctggaggtc
ttttttgtccggcacggcttcctcggattggcgaacaactggatcgatcccgtcacggag
gaagacacccgcggcatgggcagccatgccagcagccccatcggcagcagccgtttcgaa
gatttcaaagatgaagaggttcaacgcgccgccatgcgatctcttgcgccctatctcgca
gactcggcgctcgtggtgctgggaggtgacggcagcctgcgaggcgcccgggcgattcac
gagacctacggggtgcaggtcgtcggcattcccggcaccatcgacaacaacatcgccggc
accacctccctggggtttcattcggccatcgcgctggccaatcaatccattgaatccctc
aaggcaaccagcgcggccatgggcagcatctttttcgtggaggtcatgggcgcggggtcc
ggccacctggcactggcctgcgcctatcaggcccgggcggaagggatcctcgtgaatgaa
catcccgatcccgatgcctacattgaagagatcgtcctgggcacgttgaaacgcaccttg
ggtgtgcccaacaagagccacatctttgtcgtggcggagcgaactccccaccggcaccac
cgggagggcggagtccatgggctggtcgactatgtggccaacaccatcgcaacctggccg
caacgtcgggagaagtccggccactatgcattggccacggccacgaaggcgacgatcctg
gggcatacgctcaggggcgcccccccgacgccggaagataaaatgatcgcgcagcatctc
gcctacgaaaccgtccgcaggctggtcgaacaaccggacacgatcgtcggctgcatggtg
gcgtaccacgattccaaccgcctcgaaacgattcccctccacgccgtcgcgcccaaaccg
ttcgactgggagttgtttacccgcatgcacgggacggagttggcccccgacagggtctag

DBGET integrated database retrieval system