KEGG   Naumovozyma dairenensis: NDAI_0A00310Help
Entry
NDAI_0A00310      CDS       T02234                                 

Gene name
NDAI0A00310
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NDAI_0A00310 (NDAI0A00310)
Enzymes [BR:ndi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NDAI_0A00310 (NDAI0A00310)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NDAI_0A00310 (NDAI0A00310)
  Exosomal proteins of colorectal cancer cells
   NDAI_0A00310 (NDAI0A00310)
  Exosomal proteins of bladder cancer cells
   NDAI_0A00310 (NDAI0A00310)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(41297..42868)
Genome map
AA seq 523 aa AA seqDB search
MLFNKKTLFSFAALLSNLTNIQAQEAAAPADSAVIKLTKDTFADFIQENPLFLAEFFAPW
CGHCKHLAPEYVKAAAELEDKNIPLVQIDCTEEQELCMEYEIPGYPSLKVFKNNDPKNTK
DYQGARSAESIVSYMIKESLPAVQQVGTDSELQDIVQNATQPVIVDSGVKGLNATFYDVA
AKLSSDYTFISYVTSNKTVAKDLSLYLPSEDTPIVFNGDLNKLAKNATQLQEWLKVEALP
YFGEIDGSVFQTYVESDIPLAYFFYTSDEEKSKYTEFFTELGKKYRGSLNFVGLDSRKYG
RHAENLNMKEQFPLFAIHDMKKNLKYGLPQLAEEKFDQLKDTISIETKDISRLVENFVKG
KANAIVKSEPEPEVQESNVFKLVGTTHDKIVSDKKKDVLVKYYAPWCGHCKRLAPIYEEL
ADVYASDKKASSKVLIAEVDATANDISDLNIEGYPTIILYPAGKNAEPVTFTSQRTLDGF
LKFLKENGSNRVDGESLYEKYAAAKKEAEEDEEDEEDLDHDEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttatttaataagaaaacattattttcctttgcagctcttttgagtaatctaaccaac
attcaagcgcaagaagcagccgctccagctgactctgctgttatcaaattaacgaaggac
acatttgctgatttcattcaagaaaatccattattcttggcagaattcttcgctccatgg
tgtggccactgtaaacacttggctccagaatatgtcaaagctgctgctgaacttgaagat
aaaaacattccattggttcaaatcgattgtaccgaggaacaagaactttgtatggaatat
gaaatcccaggttatccatctttgaaagtttttaagaataatgatccaaaaaacactaag
gattatcaaggtgcaagatctgcggaatcgattgtttcttatatgattaaagaatcttta
ccagccgttcaacaagttggaactgattctgaattacaagacatcgtgcaaaacgctact
caaccagttattgttgattccggtgttaaaggtttaaacgctacattctatgatgttgct
gctaaattatcctccgactatactttcatttcttatgtcacctctaataagactgttgct
aaagatttatctctatatttaccatcagaagatactccaattgttttcaatggtgatcta
aacaaactagctaagaatgctacccaattacaagaatggttaaaagttgaagctttacca
tatttcggtgaaattgatggttcagttttccaaacttatgtggaaagtgatattccatta
gcttatttcttttacacatctgacgaagaaaagagtaaatatactgaattcttcactgaa
ttaggtaagaaatatcgtggttctttgaatttcgttgggttagactctagaaaatacggt
agacatgctgaaaatttgaatatgaaggaacaattcccattattcgctattcatgacatg
aagaaaaatttgaaatacggtttaccacaattagctgaagaaaaatttgatcaattaaag
gatactatttcaattgaaactaaagatatttctagattagttgaaaatttcgtaaagggt
aaagctaatgctatcgttaaatctgaacctgaaccagaagttcaagaatcaaatgtcttc
aaattggttggtacaactcatgataagattgtttccgataagaagaaggatgtcctagtt
aagtattatgctccatggtgtggccattgtaagagactggctccaatttatgaagagtta
gctgacgtttacgcttctgataagaaagctagtagtaaagtattgattgctgaagtcgat
gccactgcaaacgatatcagtgacttaaatatcgaaggttacccaacaattatattatac
ccagctggtaagaatgctgaacctgtcactttcacatctcaaagaacattagatggtttc
ttgaaattcctaaaagaaaatggttctaacagagtagacggtgaatctttgtatgaaaaa
tatgctgccgctaagaaggaagcagaagaagatgaagaagatgaagaagatcttgatcac
gatgaattataa

DBGET integrated database retrieval system